KEGG   Helicobacter pylori HPAG1: HPAG1_1219Help
Entry
HPAG1_1219        CDS       T00365                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAG1_1219
   00030 Pentose phosphate pathway
    HPAG1_1219
   00051 Fructose and mannose metabolism
    HPAG1_1219
   00052 Galactose metabolism
    HPAG1_1219
   00500 Starch and sucrose metabolism
    HPAG1_1219
   00520 Amino sugar and nucleotide sugar metabolism
    HPAG1_1219
  Nucleotide metabolism
   00230 Purine metabolism
    HPAG1_1219
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPAG1_1219
Enzymes [BR:hpa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPAG1_1219
    5.4.2.8  phosphomannomutase
     HPAG1_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282789..1284168
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRECDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPEKVNALEAYQRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQETLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLGLLEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagac
gaaaagagtgcctttagtatcggcgtggagttggggaaaatcatgcgagaatgcgataaa
agcgtgtttgtagggcatgacgccagggtgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcagcctttaatgaaatagacaatatccaatgccctaattctattatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaatccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccagagaaagtcaatgccctagaagcctatcagcgctatttg
atcaaggattttaagcatttgaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggattagaacctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacctttggtaagacgctcatg
tataaaaccgggcacagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgctcgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacactacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaaacgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggc
tttgggcttattcgtgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagaatataaaagggcgttgcttgggttattagaaaaactttaa

DBGET integrated database retrieval system