KEGG   Helicobacter pylori HPAG1: HPAG1_1233Help
Entry
HPAG1_1233        CDS       T00365                                 

Definition
(GenBank) N-(5'-phospho-ribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01130  Biosynthesis of antibiotics
hpa01230  Biosynthesis of amino acids
Module
hpa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAG1_1233
Enzymes [BR:hpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPAG1_1233
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPAG1_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABF85300
UniProt: Q1CRX2
Position
1294987..1296345
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSMLKKNHALAANINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLEIAKTYEKFASCISVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIKRLLKLQYDIIGI
NNRDLHTLTTDINNTLKLRSLLPKDALVVSESGIYSHTQIKALAPHVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTKIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKKALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVVSVMD
ANDLAPKIKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLEISPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcttagaagtttctatgcttaaa
aaaaatcacgctttagcggcaaacataaacccaagcgacagggattttaaaaaagcgtta
ctagaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttggaaatagccaagacttatgaaaaattcgcctcttgt
atttcagttttagccgattctaaatattttttaggctcttatgaaaacattaagattgtt
tcgcagcattccaccaagcccattttatgcaaagattttatcattgatgcttttcaaatc
aaactcgctagaatgatgggggctaatgcggtgcttttaatgttaagcgtgttagatgat
aaaaattatttagagcttttcaacctcgctaaatccttaaacatgagcgtgctgactgaa
gtttctaaccagcaagaaatcaagcgcttgctcaaactccaatacgacattataggcatc
aataacagggatttgcacaccctgacaaccgacattaacaacacgctcaaattgcgctct
ctcttgcctaaagacgcgctcgtggtgagtgagtccggtatttattcgcacacacaaatc
aaagccctagctcctcatgtgaatggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttaca
aaaattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgccccgatacatcaagcctaaaaaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataagattaaaaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcagctttatggctattcgcaaaaagaaatcgct
caattaaaaaaatcgctccctaaaacttgcgcgatttggcaagtagtgagtgtgatggac
gctaacgatttagcgcctaaaattaaagaagcctctctcatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggtattttagaaaatgtcaaaacg
cctttcatgttagctggtgggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttggggttggatttcaattccggtttagaaataagccctgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system