KEGG   Helicobacter pylori HPAG1: HPAG1_1234Help
Entry
HPAG1_1234        CDS       T00365                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPAG1_1234
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPAG1_1234
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAG1_1234
Enzymes [BR:hpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPAG1_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1296346..1297527
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGSHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQITESHSISA
GLDYPGVGPEHSYLKESKRAVYESASDLEALEAFSLLCQKEGIIPALESSHALAYALKFA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcggagttgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattttcgtcttttaaaagattttgtgggccgtcctagccctttaaccttgtgt
caaaacatcgtttctaaccctaaagtcaagctttatttaaaacgagaggatttaatccat
ggcggggcgcacaagactaatcaagctctagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggatcattgctgaaacaggcgctgggcagcatggcgtggcaacggctatcgct
tgcgcgttattgggtttaaaatgcgtgatttttatgggagctaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtgagagaagtcaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagagattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgctgggtcacacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccagattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctatagggatatttagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggagcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattacagaaagccacagcattagcgct
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagtaagcgtgcg
gtttatgaaagtgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgctttaaaattcgct
caaaaatgcgaagaagaaagtatcattgtggtgaatttgagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system