KEGG   Helicobacter pylori HPAG1: HPAG1_1234Help
Entry
HPAG1_1234        CDS       T00365                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPAG1_1234
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPAG1_1234
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAG1_1234
Enzymes [BR:hpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPAG1_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1296346..1297527
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGSHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQITESHSISA
GLDYPGVGPEHSYLKESKRAVYESASDLEALEAFSLLCQKEGIIPALESSHALAYALKFA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcggagttgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattttcgtcttttaaaagattttgtgggccgtcctagccctttaaccttgtgt
caaaacatcgtttctaaccctaaagtcaagctttatttaaaacgagaggatttaatccat
ggcggggcgcacaagactaatcaagctctagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggatcattgctgaaacaggcgctgggcagcatggcgtggcaacggctatcgct
tgcgcgttattgggtttaaaatgcgtgatttttatgggagctaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtgagagaagtcaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagagattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgctgggtcacacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccagattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctatagggatatttagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggagcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattacagaaagccacagcattagcgct
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagtaagcgtgcg
gtttatgaaagtgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgctttaaaattcgct
caaaaatgcgaagaagaaagtatcattgtggtgaatttgagcggtcggggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system