KEGG   Helicobacter pylori HPAG1: HPAG1_1235Help
Entry
HPAG1_1235        CDS       T00365                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPAG1_1235
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPAG1_1235
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAG1_1235
Enzymes [BR:hpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPAG1_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1297524..1298312
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIDSGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRALRDYNPHIPIGLLAYANLIFSYGVDGFYAQIKECG
VDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASVKDLEQVATHSQGYIYTLARSGV
TGASHTLKNDASAIIKTLKTFSSTPALLGFGISKKEHITNAKGMGADGVICGSALVKIIE
ENLNNENAMLEKIKGFIGGMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggtgatcccaattatgaatggagttttgaaatcattaaaaccctaatt
gatagcggggtgagcgctttagaattgggttttgctttttccgatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaagggcgctcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggtgttgatggcttttacgctcaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccaaatcaagcagatctttatcgccagccctaatgcgagcgttaaagat
ttagaacaagtcgctacgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggggcgagccatactttaaaaaatgacgcaagcgctattattaaaaccttaaaaacc
tttagctctaccccagcattactaggctttggcatttccaaaaaagaacacatcacaaac
gctaaaggcatgggtgctgatggcgtgatttgtggctcagcgttagtcaaaatcatagaa
gaaaatttaaacaatgaaaacgccatgctagaaaaaattaaagggtttataggaggaatg
attttttaa

DBGET integrated database retrieval system