KEGG   Helicobacter pylori HPAG1: HPAG1_1235Help
Entry
HPAG1_1235        CDS       T00365                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00260  Glycine, serine and threonine metabolism
hpa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01130  Biosynthesis of antibiotics
hpa01230  Biosynthesis of amino acids
Module
hpa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPAG1_1235
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPAG1_1235
Enzymes [BR:hpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPAG1_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: ABF85302
UniProt: Q1CRX0
Position
1297524..1298312
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIDSGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRALRDYNPHIPIGLLAYANLIFSYGVDGFYAQIKECG
VDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASVKDLEQVATHSQGYIYTLARSGV
TGASHTLKNDASAIIKTLKTFSSTPALLGFGISKKEHITNAKGMGADGVICGSALVKIIE
ENLNNENAMLEKIKGFIGGMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggtgatcccaattatgaatggagttttgaaatcattaaaaccctaatt
gatagcggggtgagcgctttagaattgggttttgctttttccgatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaagggcgctcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggtgttgatggcttttacgctcaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccaaatcaagcagatctttatcgccagccctaatgcgagcgttaaagat
ttagaacaagtcgctacgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggggcgagccatactttaaaaaatgacgcaagcgctattattaaaaccttaaaaacc
tttagctctaccccagcattactaggctttggcatttccaaaaaagaacacatcacaaac
gctaaaggcatgggtgctgatggcgtgatttgtggctcagcgttagtcaaaatcatagaa
gaaaatttaaacaatgaaaacgccatgctagaaaaaattaaagggtttataggaggaatg
attttttaa

DBGET integrated database retrieval system