KEGG   Helicobacter pylori HPAG1: HPAG1_1369Help
Entry
HPAG1_1369        CDS       T00365                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPAG1_1369
Enzymes [BR:hpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPAG1_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421564..1422388
Genome map
AA seq 274 aa AA seqDB search
MMHVFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPL
EENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHL
NHIFDWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAP
NHVFCSTKAIYQAYKPETCFSQTKEWLKKPSLECLKTCDRSELNDLLKPALLTNQALRDI
ESELGKEWFFSGSGSAFFRLKNTQKGANETHCQQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcatgtctttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaa
gaaggggcttaccacaagcttatttctcgcatgtgtttagtcaaagataagctaaaggat
attattagcgtcaaaagtgcgctttccttttcactaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaaattttaaagaattttttaaaatcaaaaaat
ttttctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaatatc
cccactcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatttg
aatcacatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtg
ggtgcggacaccaattttttcatctcgcaacacaaaagcgctaacgctacttcttatggc
gaagtcattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcacca
aatcatgttttttgcagcactaaagccatctatcaagcctataaacctgaaacttgtttt
tctcaaactaaagaatggcttaaaaagccgagtttggaatgcctaaaaacttgcgacaga
agcgaattaaacgatcttttaaagccggctttactcactaaccaagccttaagagatata
gaaagcgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggcta
aaaaatactcaaaagggagcgaatgaaactcattgccagcaataa

DBGET integrated database retrieval system