KEGG   Helicobacter pylori HPAG1: HPAG1_1394Help
Entry
HPAG1_1394        CDS       T00365                                 

Definition
type III R-M system restriction enzyme (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hpa  Helicobacter pylori HPAG1
Brite
Enzymes [BR:hpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HPAG1_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444608..1447508
Genome map
AA seq 966 aa AA seqDB search
MKIKFKRLDYQEQCRDQILGVFKGIDLREPENDAQRISNPVFEIEAIKDLLLENIENLRS
KQKITQGSMGIDKSLNCDILMETGTGKTFCFLECVYALHQNYRLSKFIVLTPSNAIKLGV
LKSVGITREFFKSEYSTHLESYEDIERFILASNHKCCVLVMTFSAFNKEKNTINQSCLEN
TNLFNGAKSYMQALANMRPIVIMDEPHRFLGDKTKKYLEQLNALITLRFGATFKDDYNNL
IYALDSKKAFDCALVKSISVASVGESDECFLELKGIEKKEAAINYTNLENKTQSVKVKEH
DNLGVVTQISALEDYIVEKITKTEIRFLNGFNLLLDQKEPFSHLLEGEQEVMLKEAIKSH
FEREEGLFKKGIKALCMVFISGVNSYLSENEKPAKLALLFEKLYQQKLEEVLKKPLDENY
RAYLERTKDAIYKVHGGYFAKSKKESDEAQVIALILKEKEKLLSFDSDLRFIFSQWALQE
GWDNPNVMTICKLAPSHSNITKLQQIGRGLRLAVNDKGERITKEHADFDFVNELVVIVPQ
VEGDFVGAIQQEISEHSLIKQVFSAEELEKSGVVKKGYYGVLLETLEGLGFGEKTGDENF
KLTLNQNEFLKKEPELERLKDEKYLDFEKLKDFLKDRLVGHFRVMNKNERKTEKIKINKE
NFKKFETLWDGLNHQARIAYAIDSESLIDEIVKNINSSFKVSSKIVSVTTHKKVETMGNN
AKTEIFERESACVWSLHEFISALSNKVKLSFKSVAKVLENIDENKFNEIKKNEQESLKHL
EDLFLEIIYQNIKDKISYQMRETTIKNRKNDAFYDEKGEIREFLDGSLGVDKYEIKNSSA
QEKCLYENFMQVDSEIEKGTIEESNDTKIIVFGKLPKVKIPVGLNQTYSPDFGYVVENND
KKVLLVVETKGVEHENELRDEEKRKISTAKKFFEALKKQGVNIEYQTKLNNKQLSALINE
VLNRKD
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcaaattcaaacgattggactatcaggagcaatgccgggaccaaattttaggg
gtgtttaaggggattgatttgagagagccagaaaatgacgctcaaaggatttctaaccct
gtttttgaaatagaggcgatcaaagatcttttattagaaaatattgagaatttgcgatcg
aaacaaaaaataacccaggggagcatggggattgacaagtcgttaaactgcgatatttta
atggaaacaggcaccgggaagaccttttgctttttggaatgcgtttatgccttgcaccaa
aactaccgtttgtcaaaatttattgttttaacgccaagcaacgccattaaattaggggtt
ttaaagagcgttggaatcaccagagaattttttaaaagcgagtattctacgcatttagaa
agctatgaagatatagaaagatttattctagcgagtaaccataaatgctgcgtgttggtg
atgactttttctgccttcaataaagagaaaaacactattaatcaatcatgcttagaaaac
acgaatctattcaatggcgcaaaaagttacatgcaagctttagcgaatatgcgccctatc
gtcatcatggacgaaccgcaccgatttttaggcgataaaacaaaaaaatatttggaacaa
ttaaacgctttaatcacgctcaggtttggggcgacttttaaagatgattataataatttg
atttatgcgctagacagcaaaaaagcgtttgattgcgccctagtgaaaagcatcagcgtg
gcgtctgtgggggagagtgatgagtgttttttagagcttaaagggattgaaaaaaaagaa
gctgcaattaactacacgaatttagaaaataaaactcaaagcgtcaaggtcaaagagcat
gataatttaggggtggtaactcaaatcagcgctttagaagattacattgtagaaaaaatc
actaaaactgagattcgttttctcaatggctttaatttgttgttggatcaaaaagagcct
ttttctcatcttttagagggcgagcaagaagtgatgctgaaagaagcgataaaaagccat
tttgaaagagaagaagggctttttaaaaaagggattaaagccttgtgcatggtgtttatt
agcggggtgaatagctatttaagcgagaatgaaaagccggctaaattggcccttttattt
gaaaaactttaccaacaaaagcttgaagaagtcttaaaaaagcctttagatgaaaattac
agagcgtatttagagcgcactaaagacgctatttacaaagtgcatggagggtattttgct
aaaagcaagaaagagagcgatgaagcccaagtgatcgcgctcattttaaaagaaaaagaa
aaattgctgagttttgattccgatctcaggtttattttttcgcaatgggcgttgcaagag
gggtgggataaccctaacgtgatgacgatttgcaaattagcccctagccattccaatatc
actaaattgcaacaaatcggtagagggctaaggctcgctgtgaatgataagggcgaacgc
atcactaaagagcatgctgattttgattttgtcaatgaattggtggtgatcgtgccgcaa
gtggagggggattttgtgggagcgatccagcaagagataagcgagcacagcttgattaaa
caagtatttagcgcagaagagttagaaaaaagcggcgttgttaaaaaagggtattacggg
gttttattggagacattagagggtttgggttttggagaaaaaacaggtgatgaaaacttt
aaactcactctcaatcaaaacgaatttttaaaaaaagagccagaacttgaaagattaaaa
gatgaaaaatacttggattttgaaaaattaaaagattttttaaaagatcgtctagttggc
cattttagagttatgaacaaaaacgagcgaaaaactgaaaaaatcaaaatcaataaagaa
aattttaaaaaatttgaaaccttatgggatggtttgaatcatcaagcccggatcgcttat
gccattgatagcgagagcttgattgatgagattgtcaaaaatattaattcttcttttaag
gtcagttcaaaaatcgtttcggttacgactcataaaaaagtagaaactatgggaaataac
gccaaaacagagatttttgagcgagaaagcgcatgcgtgtggagcttgcatgaatttatc
agcgccttgtctaataaggtgaaattgagttttaaaagcgtggctaaagtgttggaaaac
attgatgaaaacaagtttaatgaaattaaaaaaaacgaacaagagagcttaaagcactta
gaagatctgtttttggaaatcatttatcaaaatattaaagataaaatctcctatcaaatg
cgcgaaacgacgattaaaaacagaaaaaacgatgcgttttatgatgaaaaaggagaaatt
agagaatttttagacgggagtttgggggtggataaatatgagattaaaaattcaagcgcc
caagaaaaatgcctgtatgaaaatttcatgcaagtggatagcgagattgaaaaaggcacg
attgaagaatctaacgacactaaaatcattgtttttggcaagctccctaaggttaaaatc
ccagtagggttgaatcaaacttatagccctgattttgggtatgtggttgaaaacaacgat
aaaaaagtgttgttagtggtagaaactaagggggttgaacatgaaaacgaattgcgcgat
gaagaaaagcgcaaaatttcaaccgctaagaaattttttgaagctttaaaaaagcaaggc
gtgaacattgaataccaaaccaagttgaataataagcaattaagcgcgttgatcaatgaa
gttttaaatcgtaaagattag

DBGET integrated database retrieval system