KEGG   Helicobacter pylori HPAG1: HPAG1_1470Help
Entry
HPAG1_1470        CDS       T00365                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPAG1_1470
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HPAG1_1470
Enzymes [BR:hpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPAG1_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1531330..1532298)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEKSERDVIKELEIPLFSVGAIRENMHEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELRQLLGLLLENFKDRLGALEVTEYNPTVSVKHNNEEEKQVLE
ILDLIIKRCKIKDKKPSFAMSS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaggctttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatctgatcccttgcatgaaagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaagacaaaaaaatagggattttgtatttagacgctcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcccttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcacagaaaaaagcgaaagagatgtgattaaggaattagaaatc
cccttatttagcgtgggtgcgataagagaaaacatgcatgaagtggttcaaaaaaccaaa
gagttattaaaagcggtggatattatttaccttagcttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaagg
caattactgggcttgcttttagaaaattttaaagaccgattaggagcgcttgaggtaacc
gaatacaaccccacggtgagcgtcaaacacaataacgaagaagaaaagcaggttttagaa
attttggatctcattattaagcgctgtaaaattaaagacaagaagccatctttcgcaatg
agtagctga

DBGET integrated database retrieval system