KEGG   Haemophilus parasuis ZJ0906: K756_00375Help
Entry
K756_00375        CDS       T02697                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hpaz  Haemophilus parasuis ZJ0906
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hpaz01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpaz01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hpaz00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:hpaz00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
75951..77168
Genome map
AA seq 405 aa AA seqDB search
MERFAKTDKLAHVRYDIRGPIHKEATRLEEEGHKILKLNIGNPAPFGFEAPAEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQYYQLKGMRDLDVGDVYIGNGVSELITMSMQALLNDGD
EILIPMPDYPLWTAAATLAGGKAVHYLCDEENEWFPDIEDIKSKITPRTKAILVINPNNP
TGAVYSRQLLLDIVAIAREHNLIIFSDEIYEKIVYDGAVHHHLAPLAPDLLTVTYNGLSK
AYRVAGFRQGWMVLNGPKNQAKGFIEGLDMLASMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNKAHELLTKIPGISCVKPKGAMYMFPKIDTEMYGIKDDQKFVYDLLQQEK
VLLVQGSGFNWHKPDHFRVVTLPYVDQLEEAIGRLAKFLQSYRQD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttttgcaaaaaccgataaattagctcacgtccgctacgatattcgtgggcct
atacataaggaagcgacccgtctggaagaagaaggacataagattttaaaattaaacatt
ggtaacccagccccattcggttttgaagcccctgcggaaattttagttgatgttattcgt
aacttaccaaccgctcaaggctattgcgactctaagggtttgtactctgctcgtaaggcg
attgtgcaatattatcaattaaaaggtatgcgtgatttagatgtcggtgatgtttacatt
ggtaacggcgtatctgaactcatcacaatgtcaatgcaagccttgttaaatgatggcgat
gagattttaattccgatgccagattatccactttggacagcggcggcaacccttgcaggc
ggtaaagcggttcattacctttgcgatgaagaaaatgagtggtttccagatattgaagat
attaaatcgaaaatcaccccaagaaccaaagcaattttggtgattaacccgaataaccca
acgggagcagtgtatagccgtcagttattattggatattgtggcgattgcccgtgaacat
aacttgattattttctcagacgaaatttacgagaaaattgtctatgacggtgcggtacat
catcatcttgcccctcttgcccctgatcttttaacggtgacttataatggtttgtcaaag
gcataccgtgtggcaggtttccgtcaaggttggatggtgttaaacggcccgaaaaatcag
gcaaaaggctttattgaaggcttagatatgcttgcgtcaatgcgtttatgtgccaacacc
ccgatgcaacacgctattcaaacagcgttaggcggttatcaaagcattaacgaatttatc
ttaccaggtggtcgtttattggaacaacgtaataaggctcacgaattgctcaccaaaatc
ccagggattagctgtgtgaaaccaaaaggggcgatgtatatgttcccgaaaattgatacg
gaaatgtacggtatcaaagacgatcaaaaatttgtttacgatctgcttcaacaggaaaaa
gtgttgctggttcaaggctcaggctttaactggcataaaccagaccacttccgtgtggtg
acattgccgtatgttgatcagctggaagaagcgattggacgattagcgaagtttttgcag
agttatcgtcaggattaa

DBGET integrated database retrieval system