KEGG   Haemophilus parasuis ZJ0906: K756_01725Help
Entry
K756_01725        CDS       T02697                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hpaz  Haemophilus parasuis ZJ0906
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hpaz03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
321277..322101
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETSMRGISPYLVGQKIKEIIVRQPKLRWAVSSELSTMQGATIIEIYRRAKYLI
IQTDKGDILVHLGMSGSLGILSVKENKAIDKHDHIDLITENGVILRYNDPRKFGTWLWAE
QAETAELLANLGPEPLSEAFTSGYLFEKSRNKTVAVKNFIMNNAIVVGVGNIYACESLFM
AGIHPELAAQNLTAKQCERLVTVIKEVLTKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYG
RKGEECNDCGSIIEAKVIGQRNSFYCPKCQRLPK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattacccgaagtcgaaacaagtatgagaggcatctcgccttaccttgtaggg
cagaagatcaaagagattattgttcgtcagccgaaattacgttgggctgtgagttcagag
ctttcaactatgcaaggggcgacgataattgagatttaccgccgagctaagtatttaatt
attcagacagataagggcgatattttagttcatttaggaatgtcgggatcgttgggtatt
ttatcggtcaaagagaataaggcgatagataagcacgatcatatcgatctcatcacagaa
aacggcgtaatcttacgttataacgacccacgaaaatttggaacctggctttgggcagag
caagctgaaacagcagagttattagcaaatttagggccagagcctctttcagaagccttt
acaagcggttatttatttgaaaaaagtcgcaataaaacggttgctgtgaaaaacttcatt
atgaataacgctatcgttgttggtgtgggcaacatctatgcttgcgaatcactttttatg
gctggaatccaccccgaattagccgcacaaaatctaaccgcgaaacagtgtgagagatta
gtcactgtgattaaagaggttttgacaaaagcgattatccaagggggaacgaccttgaaa
gattttattcagcctgacggaaaacctggatatttcgcccaagtattacaagtctatggt
cgcaaaggcgaggaatgtaacgattgtggctctattattgaagctaaggtaatcgggcaa
cgaaatagtttctattgtccaaagtgtcagagattaccgaagtaa

DBGET integrated database retrieval system