KEGG   Haemophilus parasuis ZJ0906: K756_04330Help
Entry
K756_04330        CDS       T02697                                 

Definition
glycoside hydrolase family protein/phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hpaz  Haemophilus parasuis ZJ0906
Brite
Enzymes [BR:hpaz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     K756_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
795495..796040
Genome map
AA seq 181 aa AA seqDB search
MSKLKTLGKVGGGVCFVSAIIAVLNTDFHGQFRTSKQGLEIIGDAEGCKREPYLCPANVL
TVGIGSTEASSGKIERKVYTDKEIAERWLVDIKNAEKCVNRYANGGDIPQSVFDVATSLT
FNAGCGTVSKSTFFRKIKSGDYVGACNELPKWVYSGGKKLRGLEIRREKEKALCLAGLIK
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctaaaaacactaggtaaagttggcggtggggtttgttttgtcagtgccatt
attgcggtgttgaatacagattttcacggtcaatttcgtacaagtaagcaagggcttgaa
attatcggcgatgcagaaggttgtaaacgtgagccttatttgtgtcctgcaaatgtgctt
accgttggcattggttcaacggaagcgtcaagcggtaagattgaaagaaaagtttacacg
gacaaagagattgcagagcgttggttggtcgatattaaaaatgcggaaaaatgcgtgaac
cgttacgcaaatggtggtgatattccgcaatcggtgtttgatgttgctacttcgctgacg
tttaatgctgggtgtggcacggtgagtaaatcgacgttctttcgtaaaatcaaatcaggc
gattatgttggtgcctgtaatgagttgcctaaatgggtttattcaggtggcaagaagtta
cgagggttagaaattcgtcgtgagaaagagaaggcgttatgtttagctgggttaataaaa
tcttaa

DBGET integrated database retrieval system