KEGG   Haemophilus parasuis ZJ0906: K756_05355Help
Entry
K756_05355        CDS       T02697                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hpaz  Haemophilus parasuis ZJ0906
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    K756_05355 (malQ)
Enzymes [BR:hpaz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     K756_05355 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001916..1003937
Genome map
AA seq 673 aa AA seqDB search
MKQNHPFLNRYFVDEHGRRVYAQPSVYGKVAKLLGSPKSRKILPLVKVVKQGEQVFIPLF
VADKTQTVHANWTLTLESGEILTGKCKRNSIDLPRDLPLGYHQLSLNGTTAECRIIVTPE
RAYQPQELAEHKKLWGAILQLYTLRSEQNWGIGDFGDLAEFLTKLAEKGGDFVGLNPIHS
LFPANPEGASPYSPSSRLWQNIAYINVGAIEAFQQSSEAQAWFNSADIQRQLNEARQKDY
VDYSQVMWLKLQGLRLAYEQFKQQDQTAFEQFITENGEALKVQGTFDALHQWLSSQFSEQ
WGWNCWDAKYQDYHTAAVQQFQQEQSDLVRFYMWLQFVAQQQLKACNELAKQLGMPIGFY
RDLAVGVADNGAETWADKDLFVLGASVGAPPDIMAPQGQNWGLSPMHPEVLQERGYQPFI
DLLRANMKDCGALRIDHILGFARLWWVSKGDSAKNGAYVKYPLEDLLSILALESQRHQCL
IIAEALGTVPKGMLEALEEKGILAYNIFYFEYDHQGSKPLANYPYQAMTTLSTHDLPTVQ
GYWKGYDFELGQKYGVYPNEKVLNILKNTRHTNKEAIRRAVEAVQPLEADSAGVTQTFNH
QLQSYVADTNSVLFGSQPEDWLNMLEPVNIPGTSTEYPNWRRKLSKTTQEIFANQTIVQL
LEKIEAKRRGILN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatcacccatttttaaatcgttacttcgtggatgaacacggtcgccgtgtt
tatgcccaaccgtccgtttatggcaaagtggcaaaattgctcggttcgccaaaaagtcgc
aaaatcctaccgcttgttaaagtcgtcaaacaaggcgagcaagtctttattccgcttttt
gtggcggataaaacccaaaccgttcacgcaaactggacgttgacccttgaaagcggtgag
attttaacgggaaaatgcaaacgcaatagcattgacctgcctcgtgatttaccccttggt
tatcatcaattaagtctaaacggcacaaccgcagaatgtcgcattatcgttacccctgaa
cgtgcttaccaaccgcaagaactggcagagcataaaaaactatggggcgcgattttacag
ctctacaccctacgttcagaacaaaactgggggatcggcgactttggtgatttagcggaa
tttttaacaaaattagcagaaaaaggcggtgattttgttgggttaaatccaattcattcg
ttattcccagccaatcctgaaggggcaagcccttacagcccatcttctcgtttatggcaa
aacattgcttatatcaacgttggggcgattgaggctttccaacaaagcagtgaggcacaa
gcgtggtttaactcggcggatattcaacgccaattaaacgaagctcgccaaaaagattat
gtcgattattcacaagtgatgtggctgaaattgcaaggcttacgcttagcctatgagcaa
tttaaacagcaagatcaaaccgcttttgagcaatttattactgaaaacggcgaagccttg
aaagtgcaaggcacgtttgatgctctacatcaatggctctcttctcaattcagcgaacaa
tggggctggaactgctgggacgcaaaatatcaagattatcacaccgctgcggtgcaacaa
ttccaacaagaacagagcgatttagtccgtttctatatgtggttgcaatttgtggcacaa
caacagctcaaagcctgtaacgaactggcaaaacagctcggtatgccgatcggtttctac
cgtgacttagctgttggcgtggcagataatggggcggaaacgtgggcggataaagatctg
ttcgtgttaggggcatctgtgggtgcaccaccggatattatggcaccgcaagggcaaaac
tggggcttatcgccaatgcaccctgaagtgttgcaagagcgtggttatcagccgtttatc
gacctactgcgtgccaatatgaaagattgtggggcattgcgtatcgaccacattctcggc
tttgcccgtttatggtgggtgtcgaaaggcgactcggcgaaaaacggtgcttatgtgaaa
tatccgttggaagatttactttcaatcttagcccttgaaagccaacgccaccaatgttta
atcattgccgaagccttgggaactgtaccgaaaggaatgttagaagccttagaggaaaaa
ggtattttagcctacaacattttctattttgagtacgaccatcaaggaagcaaaccattg
gctaactatccatatcaagcaatgaccaccctaagtacccacgatttaccgacggtacaa
ggctactggaaaggctatgatttcgagttagggcaaaaatatggcgtttacccgaatgag
aaagtgcttaacattctgaaaaacactcgccatacaaacaaagaagcgatccgccgtgcc
gttgaagcggtacaaccgctagaagcggatagtgcaggcgttactcagacctttaaccac
cagctacaaagctatgtggcagataccaacagcgtactattcggctcacaaccggaagac
tggctaaatatgctagagccggtaaatatccctggaacaagcaccgaatatccaaactgg
cgcagaaaattgagtaaaaccacacaagagatttttgcgaatcagacgattgtgcagttg
ttagaaaagattgaggcgaaacggagaggaatattaaattaa

DBGET integrated database retrieval system