KEGG   Glaesserella parasuis ZJ0906: K756_05995Help
Entry
K756_05995        CDS       T02697                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00330  Arginine and proline metabolism
hpaz00332  Carbapenem biosynthesis
hpaz01100  Metabolic pathways
hpaz01130  Biosynthesis of antibiotics
hpaz01230  Biosynthesis of amino acids
Module
hpaz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    K756_05995
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    K756_05995
Enzymes [BR:hpaz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     K756_05995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 16167037
NCBI-ProteinID: AGO16383
Position
1123947..1124972
Genome map
AA seq 341 aa AA seqDB search
MLEIVKQVAQLHEQGHRIIIVTSGAVAAGRDYLGHRELPKTLATKQLLAAVGQSQLIQVW
ESLFSIYNIKIGQMLLTRADIENKDHFLNARDTLTALLDQQIIPIINENDAVATAEFRIG
DNDNLSALVAILSQAELLILLTDQEGLYESDPRSNPNAKRIPVVEKITPEIRQMAGGSGT
TLGTGGMSTKITAADIATRSGVETAIASGERPNVIFEVAQGAEIGTRFLAQHDKIEGRKQ
WLFGAPPAGTIYIDQGAENALVEQHKSLLPTGIAKIEGQFARGEVAKICNLNGKVLALGI
SRYNSDALALIKGKKSSEIETILGYEFGSVVFHRDEMVVHY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaatcgtaaaacaagttgctcaactgcacgaacaaggacatcgcattattatt
gtaacctctggggcggttgccgctgggcgtgattacttagggcatcgtgaattgccaaaa
acgttggcaaccaaacagcttctagccgcagtcggacaaagccagcttattcaagtgtgg
gaaagcctcttttccatttataacatcaaaatcgggcaaatgcttttaacccgtgcagat
attgaaaataaagatcactttttaaatgcaagggatacgctcaccgccttgctcgatcaa
caaattatcccgattatcaatgaaaatgatgcagtggcaacggcagagtttcgtatcggc
gataacgataatttatcggcactcgtagcaattttatctcaagcagagttattgattttg
ctcaccgatcaagaagggttatacgagagtgatccacgttcaaacccaaatgccaaacgc
attcctgttgttgaaaaaatcacccctgaaattcgccaaatggcagggggaagtggtaca
accttaggcacaggcggtatgagtaccaaaatcaccgctgccgatattgccacccgttct
ggcgttgaaacagcgattgcttctggcgaacgtcctaatgtgatttttgaagtggcacaa
ggagcggaaattggcacacgcttcttagctcaacacgacaaaatcgaaggacgcaaacag
tggctctttggtgcgccgcctgctggcacaatttatatcgatcaaggggcagaaaacgca
ttagtagaacagcataaatcgctcttacctactggtattgccaaaatcgaagggcaattt
gcgcgtggtgaagtggcaaaaatttgtaaccttaacggcaaagtgcttgcccttggcatt
agtcgttataacagtgatgctctagcattaatcaaaggcaaaaaatctagcgagattgaa
accattttgggctatgaatttggttcagtagtattccaccgagatgaaatggtggtgcat
tattaa

DBGET integrated database retrieval system