KEGG   Haemophilus parasuis ZJ0906: K756_05995Help
Entry
K756_05995        CDS       T02697                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hpaz  Haemophilus parasuis ZJ0906
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpaz01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hpaz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1123947..1124972
Genome map
AA seq 341 aa AA seqDB search
MLEIVKQVAQLHEQGHRIIIVTSGAVAAGRDYLGHRELPKTLATKQLLAAVGQSQLIQVW
ESLFSIYNIKIGQMLLTRADIENKDHFLNARDTLTALLDQQIIPIINENDAVATAEFRIG
DNDNLSALVAILSQAELLILLTDQEGLYESDPRSNPNAKRIPVVEKITPEIRQMAGGSGT
TLGTGGMSTKITAADIATRSGVETAIASGERPNVIFEVAQGAEIGTRFLAQHDKIEGRKQ
WLFGAPPAGTIYIDQGAENALVEQHKSLLPTGIAKIEGQFARGEVAKICNLNGKVLALGI
SRYNSDALALIKGKKSSEIETILGYEFGSVVFHRDEMVVHY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaatcgtaaaacaagttgctcaactgcacgaacaaggacatcgcattattatt
gtaacctctggggcggttgccgctgggcgtgattacttagggcatcgtgaattgccaaaa
acgttggcaaccaaacagcttctagccgcagtcggacaaagccagcttattcaagtgtgg
gaaagcctcttttccatttataacatcaaaatcgggcaaatgcttttaacccgtgcagat
attgaaaataaagatcactttttaaatgcaagggatacgctcaccgccttgctcgatcaa
caaattatcccgattatcaatgaaaatgatgcagtggcaacggcagagtttcgtatcggc
gataacgataatttatcggcactcgtagcaattttatctcaagcagagttattgattttg
ctcaccgatcaagaagggttatacgagagtgatccacgttcaaacccaaatgccaaacgc
attcctgttgttgaaaaaatcacccctgaaattcgccaaatggcagggggaagtggtaca
accttaggcacaggcggtatgagtaccaaaatcaccgctgccgatattgccacccgttct
ggcgttgaaacagcgattgcttctggcgaacgtcctaatgtgatttttgaagtggcacaa
ggagcggaaattggcacacgcttcttagctcaacacgacaaaatcgaaggacgcaaacag
tggctctttggtgcgccgcctgctggcacaatttatatcgatcaaggggcagaaaacgca
ttagtagaacagcataaatcgctcttacctactggtattgccaaaatcgaagggcaattt
gcgcgtggtgaagtggcaaaaatttgtaaccttaacggcaaagtgcttgcccttggcatt
agtcgttataacagtgatgctctagcattaatcaaaggcaaaaaatctagcgagattgaa
accattttgggctatgaatttggttcagtagtattccaccgagatgaaatggtggtgcat
tattaa

DBGET integrated database retrieval system