KEGG   Haemophilus parasuis ZJ0906: K756_06175Help
Entry
K756_06175        CDS       T02697                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hpaz  Haemophilus parasuis ZJ0906
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hpaz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1161904..1162482)
Genome map
AA seq 192 aa AA seqDB search
MAKLYFYYSAMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRYGVGKVSSRIGISQDAR
LFKNDSNLFDEITAYIADEKLHCILIDEAQFLTKQQVYQLTEVVDKLKIPVLCYGLRTDF
QSELFEGSRYLLAWADQLEELKTICYCGHKAGFVIRMNEKGEAVKDGDQIQIGGNDSYLS
VCRLHYKEKLGI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaactctatttttattactctgcgatgaatgcagggaaatccacaactttactt
caatcatcttacaactatcaagaacgaggaatgaatacccttgtttatactgcggcgata
gatgatcgttatggcgtagggaaagtgtcctctcgaattggtatttcacaagacgctcgc
ttgttcaaaaatgatagcaatttatttgatgaaatcaccgcttacattgccgatgaaaaa
ttgcactgtattctgattgatgaagcacaatttcttaccaagcaacaggtttatcaactg
actgaagtggtcgataaattaaaaatccctgtgctttgttacggcttacgcaccgatttc
caatctgaattatttgagggcagccgctatttactggcttgggcagatcagctcgaagaa
cttaaaaccatctgttattgtgggcataaagcaggttttgttattcgtatgaatgagaaa
ggcgaagcggtaaaagatggagatcaaatccaaattggtggaaacgatagctatctttct
gtatgccgtttgcattataaggaaaaattggggatataa

DBGET integrated database retrieval system