KEGG   Haemophilus parasuis ZJ0906: K756_07500Help
Entry
K756_07500        CDS       T02697                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hpaz  Haemophilus parasuis ZJ0906
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hpaz00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hpaz00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1419420..1420868)
Genome map
AA seq 482 aa AA seqDB search
MYKCPFDHGSKTLTTAAGAPVVDNDNTMSAGPRGPLLLQDVWFQEKLAHFARERIPERVV
HAKGSAAYGTFTVTADITKYTKAAVFKPGAQTEVLLRFSTVAGERGAADAERDVRGFSLK
FYTEQGNWDLVGNNTPVFFIRDPLKFPDFIHTQKRNPQTNLRDANAAWDFWSRHPESMHQ
IMTLFSDRGIPATLRHMNGYGSHTYSFVNANNERFWVKFHFKTQQGHKFFTNEEAAKVVG
EDRESSQKDLYEAIERGEFPRWTVQVQIMPEADAHKHNYAFDLTKVWPHADYPVIEVGVL
ELNRNPQNYFAEVEQAAFAPSNIVPGIGFSPDRMLQGRLFSYQDAQRYRLGVNHHQIPVN
APKCPYHTTHRDGAMRVDANGGNHPNYAPNRFDTYVPTHDQLPLQIEREAAHFNFREYDE
DYYSQPAALYNLFTAEEKDRLAGNFAAGLSGVTIPEIVERQMAHFEKVSPELANAIRQKL
AK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatgtccatttgatcacggatcaaaaaccttaacaacagcagcaggcgcccct
gttgttgataatgacaacacaatgtctgctggcccacgtggtccacttcttttacaagat
gtatggtttcaagagaaattagcacactttgctcgtgagcgtattcctgagcgtgtggtt
cacgctaaaggttcagcagcttacggtacattcactgtcactgcagatattaccaaatac
acaaaagctgcagtatttaaaccgggagcgcaaactgaagtattattacgtttctcaact
gttgctggtgagcgtggggctgccgatgcagagcgtgacgtgcgtggtttttcattaaaa
ttctatacagaacaaggtaactgggacttagtgggtaacaatacacccgtattttttatc
cgtgatccattaaaattcccagattttatccatacacaaaaacgtaatccacaaactaac
ttgcgtgacgcgaatgcagcgtgggatttctggtcacgtcaccctgaatcaatgcaccaa
attatgacattgttctcagatcgtggtattcctgcgactttacgtcatatgaacggttac
ggtagccacacttatagctttgtaaacgcaaacaacgagcgtttctgggtgaaattccac
ttcaaaacacaacaaggtcacaaattcttcactaacgaagaagcggctaaagttgtaggt
gaagatcgtgaatctagccaaaaagatttatatgaagcgattgagcgtggtgaattccca
cgttggactgttcaagtgcagattatgccagaagcagatgctcacaaacataactatgcc
tttgacttaactaaagtatggccacacgcagattacccagtaatcgaagtgggtgtatta
gagttaaaccgcaatccacaaaactacttcgcagaagtagagcaagcagcgtttgcacca
tctaacatcgttccgggaatcggcttctcaccagaccgtatgttacaaggtcgtctgttc
tcttaccaagatgcacagcgttaccgtttaggtgtaaaccaccaccaaatccctgtaaat
gcaccaaaatgcccataccacacgactcaccgtgatggtgcgatgcgtgtagatgcaaac
ggtggtaaccaccctaactacgctccgaaccgttttgatacttatgtgccaacccacgat
caattaccattacaaattgagcgtgaagctgcacactttaacttccgtgagtacgatgaa
gattactactcacaaccagcagcactttataacttgtttacagcggaagaaaaagatcgc
ttagcaggtaactttgctgcaggtttatcaggtgtgactatccctgaaatcgtagaaaga
caaatggctcactttgaaaaagttagcccggaattagcaaatgcgattcgtcaaaaatta
gcaaaataa

DBGET integrated database retrieval system