KEGG   Glaesserella parasuis ZJ0906: K756_10605Help
Entry
K756_10605        CDS       T02697                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00051  Fructose and mannose metabolism
hpaz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    K756_10605
Enzymes [BR:hpaz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     K756_10605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 16166329
NCBI-ProteinID: AGO17226
Position
complement(2028900..2029553)
Genome map
AA seq 217 aa AA seqDB search
MNRQTLARKIIDTCLEMTRLGLNQGTAGNISVRYQDGMLITPSGMPYEKMTEDDIVYVDN
EGNFEAGKLPSSEWQFHLAVYQTRPELNAVVHNHAINCTGVSILNKDIPAIHYMIAVTGT
NHVPCVPYATFGTWQLAEYVKQGIAKSKAILLQHHGMIAAEVNLEKALWVAHEVEVLAQW
YLKLLATTPDVPVLSDEEIKVVLGKFSTYGLRVEEKH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcaaacattagcgagaaaaattattgacacctgtttggaaatgacccgtttg
ggtttaaaccaaggcacggcaggaaacatcagtgtccgttatcaagacggtatgctgatc
accccatcaggtatgccttatgaaaaaatgacagaagacgatattgtctatgtggataac
gaaggcaattttgaagcaggaaaactgccgtcaagtgaatggcaatttcaccttgccgtg
taccaaactcgtccagagttaaatgcagtggtgcataaccacgctatcaactgcacaggt
gtatctatcttaaataaagatattccagctattcactatatgattgctgttacggggaca
aatcacgttccgtgtgtaccttatgctactttcggtacttggcaacttgcggaatatgta
aaacaaggtatcgcaaaaagcaaagcgattttattacaacatcacggaatgattgctgct
gaagtcaatctggaaaaagccctttgggtggctcacgaagttgaagtgttagcccaatgg
tatctgaaactattggcaacgacaccagatgtcccagtcctttctgatgaagagatcaaa
gtcgttttaggaaaattttccacttatggattgagagtggaagagaaacattaa

DBGET integrated database retrieval system