KEGG   Haemophilus parasuis ZJ0906: K756_10605Help
Entry
K756_10605        CDS       T02697                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpaz  Haemophilus parasuis ZJ0906
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpaz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2028900..2029553)
Genome map
AA seq 217 aa AA seqDB search
MNRQTLARKIIDTCLEMTRLGLNQGTAGNISVRYQDGMLITPSGMPYEKMTEDDIVYVDN
EGNFEAGKLPSSEWQFHLAVYQTRPELNAVVHNHAINCTGVSILNKDIPAIHYMIAVTGT
NHVPCVPYATFGTWQLAEYVKQGIAKSKAILLQHHGMIAAEVNLEKALWVAHEVEVLAQW
YLKLLATTPDVPVLSDEEIKVVLGKFSTYGLRVEEKH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcaaacattagcgagaaaaattattgacacctgtttggaaatgacccgtttg
ggtttaaaccaaggcacggcaggaaacatcagtgtccgttatcaagacggtatgctgatc
accccatcaggtatgccttatgaaaaaatgacagaagacgatattgtctatgtggataac
gaaggcaattttgaagcaggaaaactgccgtcaagtgaatggcaatttcaccttgccgtg
taccaaactcgtccagagttaaatgcagtggtgcataaccacgctatcaactgcacaggt
gtatctatcttaaataaagatattccagctattcactatatgattgctgttacggggaca
aatcacgttccgtgtgtaccttatgctactttcggtacttggcaacttgcggaatatgta
aaacaaggtatcgcaaaaagcaaagcgattttattacaacatcacggaatgattgctgct
gaagtcaatctggaaaaagccctttgggtggctcacgaagttgaagtgttagcccaatgg
tatctgaaactattggcaacgacaccagatgtcccagtcctttctgatgaagagatcaaa
gtcgttttaggaaaattttccacttatggattgagagtggaagagaaacattaa

DBGET integrated database retrieval system