KEGG   Haemophilus parasuis ZJ0906: K756_11110Help
Entry
K756_11110        CDS       T02697                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hpaz  Haemophilus parasuis ZJ0906
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    K756_11110
Enzymes [BR:hpaz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     K756_11110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2134678..2135601
Genome map
AA seq 307 aa AA seqDB search
MKNKLCVLGSINVDHVIRVPYFPKAGETLTGYGYQIAYGGKGANQAVAAARCGANVHFIG
AIGNDQIGKTMKQAFEQDGINTEAISVIENQSTGLAMIQVADLGENSIVISAGANADLSE
ALVEQHKSHIEQADILLMQLESPLQAVAKAAKIAKKAGVKVVLNPAPAQPLPDSLLSQID
IITPNETEAEILTGIKVTNEQTAAVAANYFHQLGIETVLITLGSKGLFYSEKGQGEIIPG
FLVDAVDTTAAGDTFNGAFVTALLEGKSPKESIRFAHAAAAISVTRMGAQTAIPRREEIE
ALLLFSM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaactttgtgttctcggtagtatcaatgtcgatcacgttattcgagtacct
tacttccccaaagcaggtgaaaccttaacaggttacggttatcaaattgcttatggtgga
aaaggggcaaatcaagcggttgcagcggcaagatgtggtgcaaatgtacactttattggt
gcaattggtaatgatcaaattgggaaaacaatgaagcaagcctttgaacaagacgggatc
aatacagaagcaatttctgttattgaaaaccaatcaacagggttagcgatgattcaggtt
gccgatttgggtgaaaacagtattgtgatttccgctggcgcaaatgcggatctttcagag
gctttagttgaacaacataaatcacatattgaacaagcggatattttgctaatgcagttg
gaaagtccgttacaagcggtggctaaggctgcaaaaattgccaaaaaagcaggggtaaaa
gtggtgttaaatcccgctcccgctcaacctttaccggacagtttattatcacaaattgac
attatcaccccaaatgaaacagaagcggaaatactgactggaattaaagtgaccaatgag
caaactgcagctgtagccgccaactattttcatcaacttgggatcgaaacggtcttaatt
accctaggctcaaaaggtttgttttatagcgaaaaaggacaaggtgaaattattccaggg
ttccttgtcgatgcagtggatacaacagccgcaggcgatacatttaacggagcttttgtg
acggcattattagaaggaaaatcacctaaagaatctattcgttttgctcacgcagcagcg
gcaatttcggtcacaagaatgggggcacagacagcaattcctagacgcgaggagattgag
gcgctcttattattttcaatgtaa

DBGET integrated database retrieval system