KEGG   Helicobacter pylori B38: HELPY_0095Help
Entry
HELPY_0095        CDS       T00950                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpb  Helicobacter pylori B38
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HELPY_0095 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HELPY_0095 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HELPY_0095 (thrC)
Enzymes [BR:hpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HELPY_0095 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96373..97827)
Genome map
AA seq 484 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAVLNPNAPKGGLYTLEHFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTDALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVEKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGVSGDFDDAQNALKNLLKDDDFNDALKALQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTFSPAMDILKSSNVERALFSLYGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTHEKTLVSATASYEKFP
KTTLLALNEQKKDDKTALETLKNSYNTPDSQRLDDLFERGIKHQEVLKLNEIKSSILLWL
ESLH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgctctttgaaagaaaaaaagattgattttattgaagcggta
ttaaaccccaacgcccccaaaggcgggctttacactttagagcattttgaaacgctagaa
tggcaagattgtttgaatctgagctataacgagctagtggaatgcgtgtttgagcggttg
ggattagagattcctaaaggtttattgacagacgctttaaaacgctatgaaaattttgat
aaccctaaaaacccagcccctatttttgcactcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttgcagcctttagcgagcttgttt
tctaacctagcggtagaaaaaaatgaaaagtatttaatgctcgtttccacaagtggggat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagcttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttggggtgagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgacgctttaaaagcgctccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttggaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgctaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagagacaggg
cgttacgatttaacccaccgctctttaaagcaaactttctcgccggctatggatatttta
aaaagctctaatgtggaaagggcgctttttagcctttatgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgccttaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaacgatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaacccacgaaaaaacccttgtttccgccaccgcctcttatgagaaattccct
aaaaccacccttttagccctgaatgagcaaaaaaaagacgataaaaccgccctagaaacg
cttaagaacagctacaataccccggatagccaacgccttgatgacttgtttgaaagaggg
atcaagcaccaagaagttttaaaactcaatgagatcaaatcttctatccttttgtggtta
gaaagcctacattaa

DBGET integrated database retrieval system