KEGG   Helicobacter pylori B38: HELPY_0197Help
Entry
HELPY_0197        CDS       T00950                                 

Gene name
tpi
Definition
(GenBank) Triosephosphate isomerase (TIM) (Triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00010  Glycolysis / Gluconeogenesis
hpb00051  Fructose and mannose metabolism
hpb01100  Metabolic pathways
hpb01110  Biosynthesis of secondary metabolites
hpb01120  Microbial metabolism in diverse environments
hpb01130  Biosynthesis of antibiotics
hpb01200  Carbon metabolism
hpb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELPY_0197 (tpi)
   00051 Fructose and mannose metabolism
    HELPY_0197 (tpi)
   00562 Inositol phosphate metabolism
    HELPY_0197 (tpi)
Enzymes [BR:hpb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HELPY_0197 (tpi)
Exosome [BR:hpb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HELPY_0197 (tpi)
  Exosomal proteins of bladder cancer cells
   HELPY_0197 (tpi)
  Exosomal proteins of melanoma cells
   HELPY_0197 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAX28742
UniProt: C7BY07
Structure
PDB: 

Jmol
Position
191092..191796
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPRDCGAFTGEITSQHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKSKNFKIVY
CIGEELITREKGFKAVKEFLSEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNVQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggggcacaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttcacagcatttagaagaa
ctcaaaatccacacgcttttaatagggcatagcgagaggcgagcgcttttgaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgcattggcgaagaattgataaccagagaaaagggttttaaggctgtaaaggaattttta
agcgagcaattagaaaatattgatctcaattatcctaatttagtggtggcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagacatttatctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgtg
caaaacgctaaagaaattttaggaattgatagcgtggatggcttattgatcgggagcgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system