KEGG   Helicobacter pylori B38: HELPY_0417Help
Entry
HELPY_0417        CDS       T00950                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.4.1)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpb  Helicobacter pylori B38
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HELPY_0417 (folK)
Enzymes [BR:hpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HELPY_0417 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
410486..410977
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
IYINPPFGYTNQPNFYNATIILRTCLDLREFFALVFYIERRFGRARKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSKRDSVLVPLTLQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatcctgactagccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagagtggttttagggttgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaattgggaaaatcttttcttcgccc
atttatatcaatccgccttttggttacactaatcaacctaacttttataacgctacgatc
atccttaggacatgtttagatttgcgagagttttttgctttggttttttatatagagagg
cgttttggccgtgcaaggaagcgcgattttaaagacgctccaagaactttggatattgat
attatcgctttcaaccaagtcattttaaggcagaacgatttgactttacctcatcctaaa
tggagtaaaagggattcggtgttagtgcctttgactttgcaacaaatactttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system