KEGG   Helicobacter pylori B38: HELPY_0723Help
Entry
HELPY_0723        CDS       T00950                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hpb  Helicobacter pylori B38
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hpb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hpb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(707530..708798)
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGGVEISGAKNSALPILAAALLSQQEVKIKSLPQVVDIKAMALLLQNL
GASLEWLDPNTLQISAKSLHHTEATYDLVRKMRASILVLGPLLVRFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEIAQLCAFLQSGGVEIEGVGSSELKIRGVENDALNLKDIQIIPDRIEAG
TYLCVGAITNSQLKINRIIPNHLQAITDKLIEIGFSLDIQENSIEIHPAKKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSVIEETLFENRFMHASELQRLGANISLKTNVATISGS
TELTGSDVMATDLRASSALILAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVARLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttagagattgtaggacaagtccctttaaaagggggggtagaaatttcaggg
gcgaaaaactccgcgctccccattttagccgccgcgcttttaagccaacaagaagtcaaa
atcaaatctttgccccaagtggtggatataaaggcgatggcgttattgttgcaaaattta
ggtgcaagcttggaatggcttgatcctaacacgcttcaaatcagtgctaaatccctgcac
cacaccgaagccacttacgatttggtgcgtaaaatgcgcgcttccattttggttttaggc
cctttgttagtgcgttttaaagaatgcttagtgagtttgcccggtgggtgcgctatagga
gcaaggcctgtggatttgcacttaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggctatatccatgcaaaagcccctaaaggcttgaaagggaatgatattttattt
gataagatcagcgttacaggcacagaaaacgctctcatggcagcaagcttagctaaaggg
atcacgcgcatcattaatgcggctaaagagccagaaatcgctcaattgtgcgcgttttta
cagagtgggggggtagaaattgagggtgttggtagcagcgagctaaagattaggggggta
gaaaatgacgctttaaatttaaaagacattcaaatcatacccgataggattgaagcaggc
acttatttatgcgtgggggctatcactaacagccagcttaaaatcaatcgtatcatacct
aaccatcttcaagcgatcaccgataagcttatagaaattggtttttcgctagacattcaa
gaaaattctatagaaattcatccggccaaaaaacgccaagcctttgaaatcaccacgaaa
gaatacccaggctttcccacagacatgcaagcgcaattcatggcgttagccacgcagtgt
ttggggacgagcgtgattgaagagacgctttttgaaaaccgcttcatgcatgcgagcgag
ttgcaacgcttgggggctaatatcagcctaaaaaccaatgtggctaccattagcggatcc
acagagcttaccggaagcgatgtgatggcgaccgatttaagggcttcttcggctctcatt
ttagccgctttagtggctaagggcgtgagtagggtgcataggatttaccacttggatagg
ggttatgagagattggaggataaaatcaacgccttaggggcaaaagttgcgcgcttaaaa
gaaaaatag

DBGET integrated database retrieval system