KEGG   Helicobacter pylori B38: HELPY_0725Help
Entry
HELPY_0725        CDS       T00950                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00040  Pentose and glucuronate interconversions
hpb00052  Galactose metabolism
hpb00500  Starch and sucrose metabolism
hpb00520  Amino sugar and nucleotide sugar metabolism
hpb01100  Metabolic pathways
hpb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HELPY_0725 (galU)
   00052 Galactose metabolism
    HELPY_0725 (galU)
   00500 Starch and sucrose metabolism
    HELPY_0725 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HELPY_0725 (galU)
Enzymes [BR:hpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HELPY_0725 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 P53_C
Motif
Other DBs
NCBI-ProteinID: CAX29255
UniProt: C7BZV2
Structure
PDB: 

Jmol
Position
complement(709220..710041)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctatggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataaacctttaatccaatacgctgtg
gaagaagcgatggaagcaggctgtgaagtgatggcgatcgttacggggaggaataaacga
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagaaaaatgctgtttttcttatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggagaagccctcataggt
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgatcacccaagc
gtgttaaagcaaatgacttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtagcgttagaagaagtttcaaaatacggcgtgatcagaggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaac
ctagccgtgatagggcgctacattttaactccggatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttacgcactcaagccaaaaga
aaacggatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system