KEGG   Helicobacter pylori B38: HELPY_0782Help
Entry
HELPY_0782        CDS       T00950                                 

Definition
type III restriction enzyme R protein (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hpb  Helicobacter pylori B38
Brite
Enzymes [BR:hpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HELPY_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(777055..780000)
Genome map
AA seq 981 aa AA seqDB search
MIFEKQDYQQECIYNIITLLDGFDFKRHDALNLKDCLSQFHAACEIPVKNLSGKLNVDVL
METGTGKTFTYLNLIFALHKAYKQNKFIIFVPRKAILESVKQNIRLTKDYFHLEFKRHLK
TYTYEGAKSPSNIINHYLKNQDELSVLLLTNSAIDKEGNILNKNSENLFNAKSIFENIAD
LKPISIIDEPHLLKGEAFGKYFSKIGALYFRFGATFAKEKEHALSNVAFCLDSISAFRNY
LVKQIRIHSVMQDVQSPFLLSADSKSAKIAFYKAGILKQITLSKGEDLGKIGAQFNGVSL
VKTTKDKVYLSDGATLEKVSSYKLTQDEISTLLEKAIDLHFEKEAFLFDQNIKALSLFFI
PKIEDFRQIDNKGTPFIKTEFERLYKLKRASILARENLSPSYKEYLARDFDDSGNLRVHQ
GYFSGDSIALNKGKKESNKENIEANDIKMILSEKEKLLSFQTPLRFIFSVWALQEGWDNP
NIFTLIKLANSTSETSRHQQVGRGLRIALNQEGKRVTHGFLKGNDNAFYKINYLDMLVSG
EEVGFIEGLQKEIEASSFIGGGSALDREILAKLGLNERKINKFCDALETLNAVEFDETNN
AYKIIAPICEIMQNNEERIKSFLSDEEYHAVLSAFKMAENPTNKRDQIINANQPPEKVKI
RQNLAKEFKELWQTINAQSQLSYQNIQKTKLIESIAKAFNESQVMHEAIIFESKRYDPQT
NRIITEQSSTLKIRDYANALQKEINALLLDFAKDEHLPLKFTLELYNALNKEHFTNSPKK
AFKLLKSIIKDKLHENLLSCVSYGFCQNAFFNTAFDKTDPLYCEDGSPKTEIEKHKLGKY
KSAQTPSQNYLYETIIYDSKIEEEVSEEGVQTLEGKSIEVFAKLPKFKIPTPYKNYEPDF
AYLLKDEKGAKIFFVCETKGYEKESDIPPDEQRKMEYAKIFFEMLSQNLKNAKKEIRVVF
ATRINKQDLLNALKSALKETP
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgaaaagcaagactaccaacaagagtgtatctacaatatcatcacgctttta
gacggctttgattttaagcgccacgacgccttaaatctaaaagattgtttaagtcaattt
catgctgcatgtgaaattcctgtcaaaaatttaagcggcaagctcaatgttgatgtcttg
atggaaacaggcacgggcaagactttcacttacttgaatttgatctttgcgctccataag
gcttacaagcaaaataaattcatcatctttgtcccacgaaaagctattttggagtcggtt
aagcaaaatatccgccttacgaaagattattttcacttagaattcaaacgccacctgaag
acctacacttatgaaggggctaaatcgccaagcaatattatcaatcattaccttaaaaac
caagatgaactgagcgtcttgctcctcactaatagcgcgattgacaaggagggaaacata
ctcaataaaaacagcgaaaacctttttaacgccaaaagcatttttgaaaatatcgctgat
ttaaagcctatttccatcatagacgagccgcatttgcttaagggtgaggcgtttggtaag
tattttagtaaaataggcgcgctttattttcgctttggggcgacttttgccaaagaaaaa
gagcatgctttaagcaatgtagccttttgtttggattcaatcagcgcgtttagaaattac
cttgtcaaacaaatccgcatccattctgtcatgcaagatgtgcaaagcccgtttttgctc
agtgcggattcaaaaagcgcgaaaattgccttttacaaagcgggcattcttaaacaaatc
acgctttcaaagggagaggatttgggcaaaattggggctcaatttaacggcgtcagtttg
gttaaaaccaccaaagacaaggtttatttgagcgatggcgctacgcttgaaaaggtaagt
tcttataaactcacgcaagatgagatcagcacccttttagaaaaagccattgacttgcat
tttgaaaaagaggcgtttttatttgaccaaaacattaaagcgttaagcctgttttttatc
ccaaaaattgaggattttaggcaaattgataacaaaggcacgccctttattaaaaccgaa
tttgaaaggctttacaaactcaaacgcgcttcaattctagcaagggaaaatttatcgcca
agctataaagaatatttagcgagagattttgatgatagcggtaatttacgcgtccatcaa
ggctattttagcggcgatagcatagcgctcaataaaggcaaaaaagaaagcaataaagaa
aacattgaagccaacgatattaaaatgattttgagcgaaaaagaaaaattgctttcattt
caaacgcctttgcgttttatttttagcgtgtgggctttacaagagggttgggataatcca
aacatttttacccttattaaactggcaaattccaccagtgaaacaagccgccatcagcaa
gtggggcgcgggttaagaatcgcgcttaatcaagagggcaagcgcgttacgcatggattt
ttaaaaggcaatgacaacgccttttataaaataaactaccttgatatgctagtgagtggc
gaagaagtgggctttatagagggtttgcaaaaagagattgaagcgagtagctttattggt
ggtggcagcgcgctagacagagagattttagccaagttagggcttaatgaaagaaagatc
aataaattttgcgatgcattagaaacattaaacgccgtagaatttgacgaaacaaacaac
gcttacaaaatcattgcccctatttgcgagataatgcaaaacaacgaagaaaggataaaa
agctttttaagcgatgaagaatatcacgccgttttaagcgcctttaaaatggctgaaaat
ccaaccaacaagcgcgatcaaattataaacgccaaccaacctccagaaaaagtcaaaatc
cgccaaaatttagctaaggaatttaaagagttgtggcaaaccatcaacgcgcaaagccaa
ttaagctatcaaaatatccaaaaaaccaagctgatagaatctatcgccaaagcgtttaat
gaaagccaagtgatgcatgaggcaatcatttttgaaagcaaaaggtatgacccacaaacc
aacaggatcatcacagagcaatcaagcaccctaaaaatcagagactacgctaacgcttta
caaaaagaaataaacgcgcttctgcttgactttgccaaagatgagcacttacccttaaaa
ttcacgcttgaactctacaacgctttaaacaaagagcatttcacaaactcacctaaaaaa
gcctttaaattgcttaaaagtatcattaaagataagttgcatgaaaatttgctttcttgc
gtgagttatggattttgccaaaacgccttttttaacaccgcttttgataaaaccgatccg
ctttattgtgaagatggctcgcccaaaactgagattgaaaaacacaaattaggcaaatac
aaaagcgcgcaaactccaagccaaaactatctttatgagacgatcatttatgattctaaa
attgaagaagaagtgagtgaagagggggtgcaaacactggaaggtaaaagtatagaagtt
tttgccaagctccctaaatttaaaatcccaacgccttataaaaactatgagcccgatttt
gcttatttgcttaaagatgaaaagggtgcaaaaatcttttttgtttgcgaaaccaaaggt
tatgaaaaagaaagcgacatcccgccagatgaacagcgtaaaatggaatacgctaagatc
ttttttgaaatgctatctcaaaatttaaagaacgcaaaaaaagaaatacgagtcgttttt
gccacacgcattaacaaacaagatttattaaacgcgcttaaaagcgcattaaaggaaacg
ccatga

DBGET integrated database retrieval system