KEGG   Helicobacter pylori B38: HELPY_0912Help
Entry
HELPY_0912        CDS       T00950                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hpb  Helicobacter pylori B38
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HELPY_0912 (folE)
Enzymes [BR:hpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HELPY_0912 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
913699..914241
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFLGNISVGYIPKEKIVGISAIAKLIEIYSKRLQIQERLTTQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDPKTRAEFMQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccaattttttgaaaatatcggcgaagacaagaatcgagaaggt
ttgaaagagacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagaccctagagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgaacaccatttgctcccttttttgggg
aatattagcgtgggatatatccctaaggaaaagattgtaggcattagcgcgatcgctaaa
ctcattgaaatttatagcaaacgcctacaaatccaagaaaggctgaccactcaaattgca
gaaacctttgatgaaatcatagagccaagaggcgtgatcgtggtttgtgaagccaaacat
ttgtgcatgagcatgcaaggggtgcaaaagcaaaatgcgatcattaaaacaagcgtgtta
agaggcctctttaaaaaagaccctaaaaccagagctgaatttatgcaactcttaaaatct
tag

DBGET integrated database retrieval system