KEGG   Helicobacter pylori B38: HELPY_0942Help
Entry
HELPY_0942        CDS       T00950                                 

Gene name
rluC
Definition
Pseudouridine synthase (RNA-uridine isomerase) (RNA pseudouridylate synthase) (EC:4.2.1.70)
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
hpb  Helicobacter pylori B38
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(937482..938210)
Genome map
AA seq 242 aa AA seqDB search
MEKAYKILSVQENISHKKAKALIDLGLVSIGGKKLMVARKELPKNTHFSVQKVEKPGVIF
EDENILALFKPPFIESYDLVSFFKGWVLLHRLDKETSGVILLVKENSEFHLKAKKAFKDR
AVKKEYLAIVQGIVEEEREINAPILTIKTTKAFSKISKKGQEAVTIITPLKIINKKTLLK
VGIKTGRTHQIRVHLKHINHPIIGDTLYNNEPGSAKRLMLHAHKIALLGYEFEAIPPKEF
EF
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcttataaaatattgagcgttcaagaaaacatttcgcataaaaaagctaaa
gctttgattgatttggggttagtgagtataggggggaagaaattgatggtcgccagaaaa
gaattgcccaaaaacacgcattttagcgtccaaaaggttgaaaaacccggcgtgattttt
gaagatgaaaacattctagccctttttaaacccccctttatagagagctatgatttagtc
tcttttttcaaaggttgggttttgttgcaccgcttggataaagaaacaagcggggtgatt
ttattagtgaaagaaaattcagaattccatttaaaagctaaaaaggcttttaaagacagg
gcggttaaaaaagagtatttagcgatcgttcaagggattgtagaagaagagcgagaaatc
aacgcccccattcttacgattaaaaccactaaagctttcagtaaaatctctaaaaaaggg
caagaagcggttacgatcatcacgcccttaaaaatcatcaacaaaaaaacccttttaaaa
gtggggatcaaaaccggaagaacccaccaaatcagagtccatttaaagcacatcaaccac
cccattataggcgatacgctttataataatgagccaggttccgccaaacgcttgatgctc
catgcacataaaatcgcactgctagggtatgaatttgaagcgatcccccctaaagaattt
gaattttaa

DBGET integrated database retrieval system