KEGG   Helicobacter pylori B38: HELPY_1061Help
Entry
HELPY_1061        CDS       T00950                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hpb  Helicobacter pylori B38
Brite
Enzymes [BR:hpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HELPY_1061 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057634..1058263
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEIHKRFNLHPKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSVERIESLYIEARLRLKTL
GLDNVHVKFADGNKGWEQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALRVQKVLEKCSFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtatcaaaaaccatttgatgtgtgaagaaatccataagcgtttcaatttacac
cccaaagtgagagaggccatggagagcattgaaagggaggtttttgtgccagcccccttt
aaacactttgcctacactttgaacgcgctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggttgcgggagcggctatcaagcggcggttttgtctcaaattttcaggcgtgtt
tttagcgttgaaaggattgaaagcctgtatatagaagcacgtttgcgccttaaaactctc
ggtttagacaacgttcatgtcaaattcgctgatgggaataagggctgggagcaatacgcc
ccctacgataggattttattctctgcttgcgccaaaaatatcccccaagcgcttattgat
cagcttgaagaaggcgggatattagttgcgcccattcaagaaaacaacgagcaagtgatc
aaacgctttgtgaaacaaaataacgccttgcgcgtccaaaaagtgttagaaaaatgctcg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system