KEGG   Helicobacter pylori B38: HELPY_1072Help
Entry
HELPY_1072        CDS       T00950                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hpb  Helicobacter pylori B38
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HELPY_1072 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELPY_1072 (glk)
   00052 Galactose metabolism
    HELPY_1072 (glk)
   00500 Starch and sucrose metabolism
    HELPY_1072 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HELPY_1072 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HELPY_1072 (glk)
   00524 Butirosin and neomycin biosynthesis
    HELPY_1072 (glk)
Enzymes [BR:hpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HELPY_1072 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1069732..1070742
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVTPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactcttagccgatattggcggcacgaacgcacgc
tttggtttggaagtcaccccacgacagattgaatgcattgaagtcttgaggtgcgaagat
tttgagagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacacccattatgggggattttgtccaa
atgacgaacaaccactggactttttctattgaaacgacacggcaatgtttgactttaaaa
aaactgcttgtcatcaatgattttgtcgcacaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttgcccggcgaaggagggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagtgcggaaaggtttttaagcggt
agcggtctggtgttgatttatgaagccctgtctaagcgcaaaggtttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggggcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactcccggactt
gatggggcaggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system