KEGG   Helicobacter pylori B38: HELPY_1072Help
Entry
HELPY_1072        CDS       T00950                                 

Gene name
glk
Definition
(GenBank) Glucokinase (Glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00010  Glycolysis / Gluconeogenesis
hpb00052  Galactose metabolism
hpb00500  Starch and sucrose metabolism
hpb00520  Amino sugar and nucleotide sugar metabolism
hpb00521  Streptomycin biosynthesis
hpb01100  Metabolic pathways
hpb01110  Biosynthesis of secondary metabolites
hpb01120  Microbial metabolism in diverse environments
hpb01130  Biosynthesis of antibiotics
hpb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELPY_1072 (glk)
   00052 Galactose metabolism
    HELPY_1072 (glk)
   00500 Starch and sucrose metabolism
    HELPY_1072 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HELPY_1072 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HELPY_1072 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HELPY_1072 (glk)
Enzymes [BR:hpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HELPY_1072 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CAX29585
UniProt: C7BZI3
Position
1069732..1070742
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVTPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactcttagccgatattggcggcacgaacgcacgc
tttggtttggaagtcaccccacgacagattgaatgcattgaagtcttgaggtgcgaagat
tttgagagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacacccattatgggggattttgtccaa
atgacgaacaaccactggactttttctattgaaacgacacggcaatgtttgactttaaaa
aaactgcttgtcatcaatgattttgtcgcacaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttgcccggcgaaggagggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagtgcggaaaggtttttaagcggt
agcggtctggtgttgatttatgaagccctgtctaagcgcaaaggtttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggggcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactcccggactt
gatggggcaggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system