KEGG   Helicobacter pylori B38: HELPY_1079Help
Entry
HELPY_1079        CDS       T00950                                 

Gene name
porA
Definition
(GenBank) Pyruvate synthase subunit porA (Pyruvate oxidoreductase alpha chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit alpha)
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00010  Glycolysis / Gluconeogenesis
hpb00020  Citrate cycle (TCA cycle)
hpb00620  Pyruvate metabolism
hpb00640  Propanoate metabolism
hpb00650  Butanoate metabolism
hpb00680  Methane metabolism
hpb01100  Metabolic pathways
hpb01120  Microbial metabolism in diverse environments
hpb01130  Biosynthesis of antibiotics
hpb01200  Carbon metabolism
Module
hpb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELPY_1079 (porA)
   00020 Citrate cycle (TCA cycle)
    HELPY_1079 (porA)
   00620 Pyruvate metabolism
    HELPY_1079 (porA)
   00640 Propanoate metabolism
    HELPY_1079 (porA)
   00650 Butanoate metabolism
    HELPY_1079 (porA)
  Energy metabolism
   00680 Methane metabolism
    HELPY_1079 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HELPY_1079 (porA)
Enzymes [BR:hpb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HELPY_1079 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CAX29603
UniProt: C7BZJ0
Position
1076667..1077890
Genome map
AA seq 407 aa AA seqDB search
MARSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagtattgaattgcaagagatagaagtgtgggatggcaataccgctagttct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattatggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggaatctgaacatgccgccatgagtgcatgcgtgggagctgctgcagcaggtgga
agggttagcactgcgactagctctcaaggtttagcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgcgctttagcggcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagagattctggctggatcagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttatcaattcgtgggcgaatac
caaaccaagcattcccttttagattttgataaaccggtaagctatggtgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgctattatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaaaggcattaaagccggcgtagcgacc
atccattccttacgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagacaagagctctccagcgggcgctatgggagcgatgtttaatgag
gtaacgagcgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcgt
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system