KEGG   Helicobacter pylori B38: HELPY_1207Help
Entry
HELPY_1207        CDS       T00950                                 

Gene name
folP
Definition
Dihydropteroate synthase (DHPS) (Dihydropteroate pyrophosphorylase) (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpb  Helicobacter pylori B38
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HELPY_1207 (folP)
Enzymes [BR:hpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HELPY_1207 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1210776..1211918
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPNALKNALQKIGPEKIAQDRMRQKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLVVSASQLERLIVKCHSQPFGLKHLAQELKSHLKAPKPNAPQ
IMAILNLTPDSFYEKSRFSSKKALEEIYQLLEKGIKLIDIGAASSRPESEIIDPKIEQER
LKEVLLEIKSQKLYQCAKFSIDTYHATTAQMALEHYFSILNDVSGFNSAEMLEVAKDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRA
HDIDEHIDLIKVFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctaatgcgctcaaaaacgctttgcaaaaaatagggcca
gaaaagatcgcgcaagatcgcatgcgccaaaaaggcgttagctttgtttttgaaatccag
catctgcccttaagcgcaacgctcattttaaagcaagaggccataagcgttgggggcgat
tttgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgttggtt
gtgagcgctagccagttagaacgccttattgttaagtgccactcccaaccctttgggctt
aaacatttagcacaagaattaaaaagccacctcaaagcccctaagcctaacgccccacag
atcatggcaatcttgaatctcacgccggatagtttctatgaaaagagccggtttagtagc
aaaaaagcgcttgaagaaatctatcaattactagaaaagggtatcaaactcattgatata
ggcgcggccagttcaaggccagagagtgaaatcattgatccaaaaatagagcaagagcgc
ttaaaagaagttttattagagatcaaatcccaaaaactctaccaatgcgctaaattcagc
atagacacctaccatgccacaaccgcgcaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttaatagcgctgaaatgctagaagtcgcaaaagattacaagccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacacgctacaagatattattttagatatagggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaagaccggctc
gccggcactttgagtttgcatttaatggcgctgcaaaacggagcgagtattttaagagcg
catgacattgatgagcatatagatttaatcaaagtgtttaagagtttggaagaaacggat
tga

DBGET integrated database retrieval system