KEGG   Helicobacter pylori B38: HELPY_1254Help
Entry
HELPY_1254        CDS       T00950                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00260  Glycine, serine and threonine metabolism
hpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpb01100  Metabolic pathways
hpb01110  Biosynthesis of secondary metabolites
hpb01130  Biosynthesis of antibiotics
hpb01230  Biosynthesis of amino acids
Module
hpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HELPY_1254 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HELPY_1254 (trpA)
Enzymes [BR:hpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HELPY_1254 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: CAX29963
UniProt: C7C0I2
Position
complement(1257772..1258560)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQEKMAFIPFVTLGDPHYELSFEIVKTLMASGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLKKIRDYNHDIPIGLLAYANLIFSYGVDGFYAQIKECG
IDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASVKDLEQVAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHITNAKGMGADGVICGSALVKIIE
ENLNNENAMLEKIKGFIGGMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacaagaaaaaatggcgtttatcccg
tttgtaaccttgggcgatccacattatgaattgagttttgaaatcgttaaaaccttaatg
gctagtggggtgagcgctttagaattgggttttgctttttctgatcctgtggcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagagactacaaccatgatattcccatagggcttttagcgtat
gcgaatttaattttttcttatggcgttgatggcttttacgctcaaatcaaagaatgcggt
atagatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccaaatcaagcaaatctttatcgccagccctaatgcgagcgttaaagat
ttagaacaagtcgctatgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggggcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaacc
tttagccctacccccgcattactaggctttggcatttccaaaaaagaacacatcacaaac
gctaaaggcatgggcgctgatggcgtgatttgcggctcggcgttagtcaaaatcatagaa
gaaaatttaaacaatgaaaacgccatgctagaaaaaattaaagggtttataggaggaatg
attttttaa

DBGET integrated database retrieval system