KEGG   Helicobacter pylori B38: HELPY_1255Help
Entry
HELPY_1255        CDS       T00950                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpb  Helicobacter pylori B38
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HELPY_1255 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HELPY_1255 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HELPY_1255 (trpB)
Enzymes [BR:hpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HELPY_1255 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1258557..1259738)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIT
CALLGLKCVIFMGGKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEQENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQITESHSISA
GLDYPGVGPEHSYLKGIGRAVYESASDAEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCAQESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattttcatcttttaaaagattttgtgggccgtcctagccctttaaccctgtgt
caaaatatcgtttctaaccctaaagtcaagctttatttaaaacgagaagatttaatccat
ggcggggcgcacaagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggg
aaaacaaggatcattgctgaaacaggcgctgggcagcatggcgttgcaacggctatcact
tgcgcgttattgggtttaaaatgcgtgatttttatgggaggcaaagacatcaagcgccag
gaaatgaatgtttttagaatgcgcttattgggtgctgaagtgagagaagtcaattcaggg
agcgcgacgcttaaagacgccgtgaatgaggctttaagagattgggcgagcagctataag
gacacgcattatttgctaggcacagccgccgggccgcacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaacaagaaaaccgc
ttgcctgattatgtgatcgcatgcgttggaggggggtctaacgctatagggatattcagc
gcgtttttaaacgataaagaggtcaaactcataggcgtagagcctgccggattagggcta
gagactaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaac
aaaacctatcttttacaagatgatgaaggccagattacagaaagccacagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagggattgggcgtgcg
gtttatgaaagcgcaagcgatgctgaagcgctagaagccttcagtttgctatgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgctttagcgtatgccttaaagctcgct
caaaaatgcgcacaagaaagtatcatcgtagtgaatttaagcggtcggggagataaggat
ttaagcaccgtttataacgctttaaaagggggtttaaaatga

DBGET integrated database retrieval system