KEGG   Helicobacter pylori B38: HELPY_1432Help
Entry
HELPY_1432        CDS       T00950                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpb  Helicobacter pylori B38
Brite
Enzymes [BR:hpb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HELPY_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1415232..1416284
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCVYALNDLELIKKARESQLEPMPMGKALKEYQIKKTRDVGIGAKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLNLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALRGKKPKILYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcctggctttttcttgcgtttatgccttgaac
gatttagaattgatcaaaaaagcgagggaaagccagttagaacccatgcctatgggcaaa
gcgctcaaagaataccagatcaaaaaaaccagagatgtgggcattggcgctaaaaacagc
gaaatcatgacctccgctcaagtggaattgggcaaaatgctctattttgaccctaggatc
tccacttcctacctcgtgtcttgcaacacatgccataatttgggcttaggcggggtggat
ttagttccaagcgcggtaggctctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatggtagggttacgcatcta
aacgaacaagcgcaaggacccatccagtcttcttttgaaatgggggctgatcctaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaaactctttagaaaagcttatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccacg
cttattaccccaagccgttacgatgattttttaaggggcaatcctaaagcgctcagcaaa
gccgaaaaagaagggttgaatttattcatttctaaaggctgtgtggcttgccataacggc
atcaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattctgggatgttaaagatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttgaagccttaaggggtaaaaaacctaaaatactctatccagaactccctgta
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system