KEGG   Helicobacter pylori B38: HELPY_1432Help
Entry
HELPY_1432        CDS       T00950                                 

Definition
(GenBank) Putative di-haem cytochrome c peroxidase; putative signal peptide
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpb  Helicobacter pylori B38
Brite
Enzymes [BR:hpb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HELPY_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 Put_Phosphatase FixO F-actin_cap_A
Motif
Other DBs
NCBI-ProteinID: CAX30136
UniProt: C7C105
Position
1415232..1416284
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCVYALNDLELIKKARESQLEPMPMGKALKEYQIKKTRDVGIGAKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLNLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALRGKKPKILYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcctggctttttcttgcgtttatgccttgaac
gatttagaattgatcaaaaaagcgagggaaagccagttagaacccatgcctatgggcaaa
gcgctcaaagaataccagatcaaaaaaaccagagatgtgggcattggcgctaaaaacagc
gaaatcatgacctccgctcaagtggaattgggcaaaatgctctattttgaccctaggatc
tccacttcctacctcgtgtcttgcaacacatgccataatttgggcttaggcggggtggat
ttagttccaagcgcggtaggctctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatggtagggttacgcatcta
aacgaacaagcgcaaggacccatccagtcttcttttgaaatgggggctgatcctaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaaactctttagaaaagcttatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccacg
cttattaccccaagccgttacgatgattttttaaggggcaatcctaaagcgctcagcaaa
gccgaaaaagaagggttgaatttattcatttctaaaggctgtgtggcttgccataacggc
atcaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattctgggatgttaaagatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttgaagccttaaggggtaaaaaacctaaaatactctatccagaactccctgta
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system