KEGG   Helicobacter pylori B38: HELPY_1492Help
Entry
HELPY_1492        CDS       T00950                                 

Gene name
res
Definition
type III R-M system restriction enzyme (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hpb  Helicobacter pylori B38
Brite
Enzymes [BR:hpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HELPY_1492 (res)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1478213..1481119)
Genome map
AA seq 968 aa AA seqDB search
MKIKFKRLDYQEQCRDQILGVFKGVYFEESKEDIQRISNPVFETEAIKDVLLENIENLRS
KQKITQGSVGIEKSLNCDILMETGTGKTFCFLECVYALHKNYRLSKFIVLTPSNAIKLGV
LKSIEITREFFKSEYSTHLESYEDIERFILASNHKCCVLVMTFSAFNKEKNTINQSCLEN
INLFNGAKSYMQALASMRPIVIMDEPHRFLGDKTKKYLEQLNALLTLRFGATFKDDYNNL
IYALDSKKAFDCALVKSISVASVGESDECFLELKEANKKQNEATINYTNLENKTQSVKVK
EHDNLGTLTHISALEDYIVEKITKTEIRFLNGFNLLLDQKEPFSHLLEGEQEVMLKEAIK
SHFEREEGLFKKGIKALCMVFISGVNSYLSENEQPAKLALLFEKLYQQKLEEVLKKPLDE
NYRAYLERTKEAIYKVHGGYFAKSKKESDEAQVIALILKEKEKLLSFDSDLRFIFSQWAL
QEGWDNPNVMTICKLAPSHSNITKLQQIGRGLRLAVNDRGERITKEHADFDFVNELVVIV
PQVEGDFVGAIQQEISEHSLIKQVFSAEELEKSGMVKKGYYGVLLETLEGLGFGEKTDDE
NFKLTLNQNEFLKKEPELERLKDEKYLDFEKLKDFLKDRLIGNSRVRNKNERKSEKIKIN
KENFKKFETLWESLNHQARITYAIDSESLIDEIVKNINSSFNVKSKIVSVTTHKKVETMG
NNAKTEIFERESACVWSLHEFISALSNKVKLSFKSVAKVLEKIDKNKFDLIKKNEQEGLR
RLEELFLEIIYQNIKDKISYQIRETTIKNRKNDAFYDEKGEIREFLDGNLRGDKYEIKNS
SAREKCLYENFMQVDSEIEKDTIEESNDTKIIVFGKLPRVKIPIGLNQTYSPDFGYVVEN
NDKKVLLVVETKGVEHESELRNEERRKISTAKKFFEALKKQGVNIEYETKMGKDQLSALI
NEVLNRKD
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcaaattcaaacgattggactatcaggagcaatgccgggaccaaattttaggg
gtgtttaagggggtctattttgaagagtcaaaagaagatattcaaaggatttctaaccct
gtttttgaaacagaggcgatcaaagatgttttattagaaaatattgagaatttgcgatcg
aaacaaaaaataacccagggaagcgtggggattgagaagtcgttaaactgcgatatttta
atggaaacaggcaccgggaagaccttttgctttttggaatgcgtttatgccttgcacaaa
aactaccgtttgtcaaaatttatcgttttaacgccaagcaacgccattaaattaggggtt
ttaaagagtattgaaatcaccagagaattttttaaaagcgagtattctacgcatttagaa
agctatgaagatatagaaagatttattctagcgagtaatcacaaatgctgcgtgttggtg
atgactttttctgccttcaataaagagaaaaatactatcaatcaatcatgcttagaaaac
ataaatctattcaatggtgcaaaaagttacatgcaagctttagcgagtatgcgccccatc
gtaatcatggacgaaccacaccggtttttaggcgataaaacaaaaaaatatttggagcaa
ttaaacgctttactcacgctcaggtttggggcgacttttaaagatgattataataatctg
atttacgcgctagacagcaaaaaagcgtttgattgcgccctagtgaaaagcatcagcgtg
gcgtctgtgggggagagtgatgagtgttttttagagcttaaagaggctaacaaaaaacaa
aatgaagcgacgatcaattacacgaatttggaaaataaaactcaaagcgtcaaagtcaaa
gagcatgataatttaggcacactaactcatatcagcgctttagaagattacattgtagaa
aaaatcactaaaactgagattcgttttctcaatggctttaatttgttactggatcaaaaa
gagcctttttctcatcttttagagggcgaacaagaagtgatgctgaaagaagcgataaaa
agccattttgaaagagaagaagggctttttaaaaaggggattaaagccttgtgcatggtg
tttattagcggggtgaatagctatttaagcgaaaatgaacagccggccaaattagccctt
ttatttgaaaaactctaccaacaaaagcttgaagaagtcttaaaaaagcctttagatgaa
aattatagagcgtatttagagcgcaccaaagaagctatttacaaagtgcatggagggtat
tttgctaaaagcaagaaagagagcgatgaagcccaagtgatcgcgctcattttaaaagaa
aaagaaaaattgctgagttttgattccgatctcaggtttattttttcgcaatgggcgttg
caagaggggtgggataaccctaatgtgatgacgatttgcaaattagcccccagccattct
aatatcactaaattgcaacaaatcggtagggggttaaggctcgctgtgaatgataggggc
gaacgcatcactaaagagcatgctgattttgattttgtcaatgaattagtcgtgatcgtg
ccgcaagtggagggggattttgtgggagcgatccagcaagagataagcgaacacagcttg
atcaaacaagtatttagcgcagaagagctagaaaaaagcggcatggttaaaaaagggtat
tacggggttttattggaaacattagagggtttgggttttggagaaaaaacagatgatgaa
aattttaaactcaccctcaatcaaaacgaatttttaaaaaaagagccggaactagaaaga
ttaaaagatgaaaaatacctggattttgaaaaattaaaagattttttaaaagatcgcttg
attggtaattccagagttaggaacaaaaacgagcgaaagagtgaaaaaatcaaaatcaat
aaagaaaattttaaaaaatttgaaaccttatgggagagcttgaatcatcaagcccggatc
acttatgccattgatagcgagagcttgattgatgagattgtcaaaaatattaattcttct
tttaatgtcaagtcaaaaatcgtttcggttacgacgcataaaaaagtagaaacgatggga
aataacgccaaaacagagatttttgagcgagaaagcgcatgcgtgtggagcttgcatgaa
tttatcagcgccttgtccaataaggtgaaattgagttttaaaagcgtggctaaagtgttg
gaaaaaattgataaaaacaaatttgatctgattaagaaaaacgaacaagagggcttaagg
cggttagaagagctgtttttggaaatcatttatcaaaatattaaagataaaatctcctat
caaatacgcgaaacgacgattaaaaacagaaaaaacgatgcgttttatgatgaaaaagga
gaaattagagaatttttagacgggaatttgaggggggataaatatgagattaaaaattca
agcgcgcgagaaaaatgcctgtatgaaaatttcatgcaagtggatagcgagattgaaaaa
gacacgattgaagaatctaacgacactaaaatcattgtttttggtaagctccctagggtt
aaaatcccaatagggttaaatcaaacttatagccctgattttgggtatgtggttgaaaat
aacgataaaaaagtgttgttagtggtagaaactaagggggttgaacatgaaagcgaattg
cgcaatgaagaaaggcggaaaatttcaaccgctaagaaattttttgaagctttaaaaaag
caaggcgtgaatattgaatacgaaaccaaaatgggaaaagatcaattaagcgcgttgatc
aatgaagttttaaatcgtaaagattag

DBGET integrated database retrieval system