KEGG   Helicobacter pylori B38: HELPY_1512Help
Entry
HELPY_1512        CDS       T00950                                 

Gene name
rocF
Definition
Arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpb  Helicobacter pylori B38
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HELPY_1512 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HELPY_1512 (rocF)
Enzymes [BR:hpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HELPY_1512 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1504232..1505200)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSKTHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLGAVEVTEYNPTVSTKHNNEEEKQVLE
ILDLIIKCCKIKDKERSFAMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcggagttaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttgagtaaaacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgaaaaa
aaagaattccctttgattttaagctcagagcacgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaagacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagtgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttacttgagtctggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaactcaag
caattactgggcttgcttttagaaagttttaaagaccgattaggggctgttgaggtaacc
gaatacaaccccacggtgagcaccaaacacaataacgaagaagaaaagcaggttttagaa
attttggatctcatcattaagtgctgtaaaattaaagacaaggagcgatcttttgcaatg
agtcgctga

DBGET integrated database retrieval system