KEGG   Helicobacter pylori B38: HELPY_1512Help
Entry
HELPY_1512        CDS       T00950                                 

Gene name
rocF
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpb  Helicobacter pylori B38
Pathway
hpb00220  Arginine biosynthesis
hpb00330  Arginine and proline metabolism
hpb01100  Metabolic pathways
hpb01110  Biosynthesis of secondary metabolites
hpb01130  Biosynthesis of antibiotics
hpb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpb00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HELPY_1512 (rocF)
   00330 Arginine and proline metabolism
    HELPY_1512 (rocF)
Enzymes [BR:hpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HELPY_1512 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAX30214
UniProt: C7C183
Structure
PDB: 

Jmol
Position
complement(1504232..1505200)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSKTHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLGAVEVTEYNPTVSTKHNNEEEKQVLE
ILDLIIKCCKIKDKERSFAMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcggagttaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttgagtaaaacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgaaaaa
aaagaattccctttgattttaagctcagagcacgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaagacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagtgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttacttgagtctggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaactcaag
caattactgggcttgcttttagaaagttttaaagaccgattaggggctgttgaggtaacc
gaatacaaccccacggtgagcaccaaacacaataacgaagaagaaaagcaggttttagaa
attttggatctcatcattaagtgctgtaaaattaaagacaaggagcgatcttttgcaatg
agtcgctga

DBGET integrated database retrieval system