KEGG   Helicobacter pylori PeCan4: HPPC_00830Help
Entry
HPPC_00830        CDS       T01322                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPPC_00830
Enzymes [BR:hpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HPPC_00830
Exosome [BR:hpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPPC_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(159908..160879)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMIRETRLNIDDFIAPLFVIESDSCIKNEINSMPGVYQMSIEPLL
KECEELVGLGIKAVLLFGIPKHKDATGSHALNKDHIVAKAARAIKKRFKDLIVIADLCFC
EYTDHGHCGILENASVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDKA
GYTHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANKKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaacttaagagcgatgataagagaa
acgcgtctgaatattgatgatttcatcgctcccttatttgtcatagaaagcgatagttgt
attaaaaatgagatcaactccatgcctggcgtttatcaaatgagtatagagcctctttta
aaagaatgcgaagaattagtgggtttaggcatcaaagccgttttattgtttggcattcct
aaacataaggacgctacaggaagccatgcgttaaataaggatcacattgtcgcaaaagcc
gctagagcgattaaaaaacgatttaaggatttaatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgcttctgtgtctaacgataaa
acgctagagattttaaaccttcaagggcttattttggctgaaagcggtgtggatattcta
gccccaagcaacatgatggatgggaatgttttaagtttgagaaaaacgctagataaggcc
ggctatacccacacgcccatcatgagctattccactaaatttgcgagcagttactatggg
ccttttagagatgtggcaaactctgcgccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaataaaaaagaagcgcttttagaaagtttagaagatgaaaaacagggcgcg
gatattttaatggtgaaaccggctttggcgtatttggatattgttaaagaaatcagagat
cacactttgctccctttagcgctctataatgtgagtggggaatacgccatgctcaaactc
gctcaaaaacacaacctgatcaactatgaaagcgttttattagaaacgatgacttgtttt
aaaagagcgggagcggatatgattattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system