KEGG   Helicobacter pylori PeCan4: HPPC_00970Help
Entry
HPPC_00970        CDS       T01322                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00010  Glycolysis / Gluconeogenesis
hpc00051  Fructose and mannose metabolism
hpc01100  Metabolic pathways
hpc01110  Biosynthesis of secondary metabolites
hpc01120  Microbial metabolism in diverse environments
hpc01130  Biosynthesis of antibiotics
hpc01200  Carbon metabolism
hpc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC_00970 (tpiA)
   00051 Fructose and mannose metabolism
    HPPC_00970 (tpiA)
   00562 Inositol phosphate metabolism
    HPPC_00970 (tpiA)
Enzymes [BR:hpc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPPC_00970 (tpiA)
Exosome [BR:hpc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPPC_00970 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPPC_00970 (tpiA)
  Exosomal proteins of melanoma cells
   HPPC_00970 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADO06443
UniProt: E1Q4M4
Position
189099..189803
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPVFKSHAYLEELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPKDCGAFTGEITSWHLEELKINTLLIGHSERRLLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEEIYLTHG
FLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaagtccgctatgcctgtttttaaaagccatgcg
tatttagaagaattagaaaagactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagcgcaaaac
gcttaccctaaagattgtggggcttttaccggtgaaatcacttcatggcatttagaagaa
ctcaaaatcaacacgcttttaatagggcatagcgagaggcgattgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaagattgtctat
tgcattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aacgagcaattagaaaatattgatcttaattatcctaatttagtggtggcgtatgagcct
atttgggcgattggcacaaaaaagagtgcttctttagaagagatttacctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgcg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgatcgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system