KEGG   Helicobacter pylori PeCan4: HPPC_01060Help
Entry
HPPC_01060        CDS       T01322                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00300  Lysine biosynthesis
hpc01100  Metabolic pathways
hpc01120  Microbial metabolism in diverse environments
hpc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPPC_01060
Enzymes [BR:hpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPPC_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADO06461
UniProt: E1Q4P2
Position
complement(206465..207631)
Genome map
AA seq 388 aa AA seqDB search
MNALEITQKLISYPTITPKECGIFEYIKSLFPTFKTLECGENGVKNLFLYRIFNPPKEHA
KKEHAKEKHAKENVKPLHFCFAGHIDVVPPGNHWQSDPFKPIIKEGFLYGRGAQDMKGGV
GAFLSASLNFNPKTPFMLSVLLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAIVAEPTCEK
VLGDSIKIGRRGSINGKLILKGTQGHAAYPQKCQNPIDALASVLPLISGVHLDDGDEYFD
PSKLVITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKNAPHTLELESS
SSPFITASHSKLTSVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIH
AIDERVSLKELELLEKVFLGVLEDLSEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttagaaatcacccaaaagctcatcagctaccccaccatcacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctacttttaaaactctagagtgtgga
gaaaatggcgtgaaaaacctttttttataccgcatttttaaccctcccaaagagcatgca
aaaaaagaacatgcaaaagaaaagcatgcaaaagaaaatgttaagcccttgcatttttgc
tttgcggggcatattgatgtcgtgcctcctggaaatcattggcaaagcgatccctttaaa
cccattattaaagaggggtttttatacggccgtggggcgcaagacatgaaaggaggcgtg
ggggcgtttttgagcgcgagtttaaattttaaccctaaaacccctttcatgctttctgtt
ttactcacaagcgatgaagaagggccagggatttttggcactaggcttatgttagaaaaa
ctcaaagaaaaagatttgctgccccatatggcgattgtggctgaacccacttgcgaaaaa
gtcctaggcgatagcatcaaaatcggccgaagaggctctattaatggcaaactcatttta
aaaggcactcaagggcatgcagcttacccgcaaaaatgccaaaaccccattgatgcactc
gcttctgttttacccttgatttcaggagtccatttagacgatggcgatgaatattttgac
ccttcaaaattggttatcaccaacttgcatgcagggttaggagcgaataatgtaacgccc
gcaagcgtagaaatcatctttaatgcgcgccattctttaaaaaccaccaaagaaagtttg
aaagaatatttagaaaaggttttaaaaaacgcgcctcacactttagaattagaatcaagc
agttcgcctttcatcacggcttctcattcaaagcttaccagcgttttaaaagaaaatatt
ttaaaaacatgccataccaccccccttttaaacaccaaaggcggcacgagcgatgcgcga
ttttttagcgctcatggcatagaagtggtggaatttggcgtcattaatgacagaatccat
gccattgatgaaagggtgagcttgaaagaattagagcttttagaaaaagtgtttttgggg
gttttagaggatttaagcgagaaatag

DBGET integrated database retrieval system