KEGG   Helicobacter pylori PeCan4: HPPC_01400Help
Entry
HPPC_01400        CDS       T01322                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPC_01400
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPC_01400
Enzymes [BR:hpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPPC_01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
271672..272247
Genome map
AA seq 191 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLGKLLE
ENARTECVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFAWRLGLSVFVETHKPDYTHLKDLGVLGVLEKVPHSQNQKK
NSFFRLNFKLI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaactaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacgcccgcacagaatgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagctctttgatt
gtccatcaagatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagatgaagagcttttgaaagaagatttaaagggcatggtggaattc
gcttggcgtttgggcttgagcgtgtttgtagaaacccacaaaccagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagttccccattctcaaaatcaaaaaaaa
aatagtttttttagattgaattttaagctaatttag

DBGET integrated database retrieval system