KEGG   Helicobacter pylori PeCan4: HPPC_01830Help
Entry
HPPC_01830        CDS       T01322                                 

Definition
hemolysin
Orthology
K06442  
23S rRNA (cytidine1920-2'-O)/16S rRNA (cytidine1409-2'-O)-methyltransferase [EC:2.1.1.226 2.1.1.227]
Organism
hpc  Helicobacter pylori PeCan4
Brite
Enzymes [BR:hpc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.226  23S rRNA (cytidine1920-2'-O)-methyltransferase
     HPPC_01830
    2.1.1.227  16S rRNA (cytidine1409-2'-O)-methyltransferase
     HPPC_01830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(363109..363816)
Genome map
AA seq 235 aa AA seqDB search
MRLDYALFNQHLANSREKAKALVLKNQVLVNKMVVSKPSFMVKEDDKIELIATNLFVSRA
GEKLAAFLETHFVDFKEKVVLDVGASKGGFSEVALLKGAKKVLCVDVGKMQLDENLRNDT
RIECYEECDIRGFKTPETIDLALCDVSFISLYCILEAILPLSDEFLALFKPQFEVGRATK
RNKKGVVVDKEAILNALENFKNHLKTKDFQILKIQESLVKGKNGNVEFFIHFKRA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttagattacgctttattcaaccagcatttagcaaatagcagagaaaaagctaaa
gcgttggttttaaaaaatcaggttttagtcaataaaatggtggtttctaaaccctctttt
atggttaaagaggacgataagattgagctcatcgctacaaacctattcgttagcagggct
ggggaaaaattagcggcttttttagaaacccatttcgtggattttaaagaaaaggtggtt
ttagatgtgggagcgagcaaggggggctttagtgaagtggctcttttaaaaggggctaaa
aaggtgctttgcgtggatgtggggaaaatgcaattagatgaaaatttaaggaacgataca
cgcatagaatgttacgaagaatgcgatattagagggtttaaaacgccagaaacaattgat
ttagcgctttgcgatgtgagctttatttctttatattgtattttagaagcgattttgcct
ttaagcgatgaatttttggcgcttttcaaaccgcaatttgaagtgggcagagcaacaaaa
cgcaataaaaagggggtggtggtggataaagaagccattttaaacgctttagaaaacttt
aaaaaccatttaaaaacaaaggattttcaaatcttaaagatccaagaaagcttagtgaaa
gggaaaaacgggaatgttgaattttttatccatttcaagcgagcatga

DBGET integrated database retrieval system