KEGG   Helicobacter pylori PeCan4: HPPC_02025Help
Entry
HPPC_02025        CDS       T01322                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00010  Glycolysis / Gluconeogenesis
hpc00620  Pyruvate metabolism
hpc00640  Propanoate metabolism
hpc00680  Methane metabolism
hpc01100  Metabolic pathways
hpc01110  Biosynthesis of secondary metabolites
hpc01120  Microbial metabolism in diverse environments
hpc01130  Biosynthesis of antibiotics
hpc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC_02025
   00620 Pyruvate metabolism
    HPPC_02025
   00640 Propanoate metabolism
    HPPC_02025
  Energy metabolism
   00680 Methane metabolism
    HPPC_02025
Enzymes [BR:hpc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPPC_02025
Lipid biosynthesis proteins [BR:hpc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPPC_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADO06648
UniProt: E1Q5N3
Position
complement(397601..399589)
Genome map
AA seq 662 aa AA seqDB search
MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANEDYEHFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIVIRNAKEIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLESLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRASCATLPLPGIHAEVLNKDGTKTKPGEQGFLCITKPWPSMV
RNIWGDEKRYIDSYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSVE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIAQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagacgatgatttagaattcgctaaaaaaatttttaaccctaacagagcgttt
gccaagcaggctaggattaaaaacatgtgcgaatataaagatttagtgcatgaagccaat
gaagattatgaacatttttggggcgagttagccaaacaaaaactcacatggtttaaacct
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaaa
atcaatgtttcttacaattgcatagacaggcatttaaaagacaaaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgataga
gtcattatctatatgcctatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttgagggatagg
atcaacgacgctcaagctaaattagttatcacagcggacgggacttttagaaaaggcaaa
ccctacatgctcaagccagcccttgacaaggctctagaaaataatgcctgccctagcgtg
gaaaaagcgctcattgtgatacgaaacgccaaagagattgactatgtgagagggcgcgat
tttgtctataatgaaatggtcaattaccaatccgataaatgcgaacctgaaatgatggac
tctgaagatcctttattcttgctctatacaagcggatcaaccgggaaacctaaaggcgtt
caacacagcagtgcagggtatttgctgtgggcacaaatgacgatggagtgggtttttgat
attagagataacgataatttttggtgcaccgctgatattggctggatcacagggcacact
tatgtggtttatgggcctttagcttgtggggcgacgactttgatactagaaggcacgatg
tcttatccggattatgggagatggtggaggatgatagaagaataccgcgtggataaattc
tacacttcccccaccgctataagaatgctgcatgccaaaggcgaaaacgaacccttaaaa
tataatttagaatcgctcaaagttttaggaacggtgggagagcccattaaccctacggca
tggaaatggttttatgaaaaaatcggtaactcaaaatgcagtatcgtggatacttggtgg
caaacagaaacaggcgggcatatcatcagccctttaccgggagctacgcctataagggcc
agctgtgcaactttacctttgcctggcatccatgcggaagttttaaacaaagacggcacc
aaaacaaagcccggagagcaagggtttttatgcatcactaagccatggccttctatggta
agaaacatttggggcgatgaaaaacgatacattgatagctatttttctcagatcaagttg
aatggggaatatgtctacctctctggagatggcgctattgtggatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagcgggcataggattggcacggct
gaagtggagagcgctatttctaaacatgaaatggtggttgaatgcgcagtagtgggtatc
cctgatacgattaaaggagagggcttgtttgcgtttgtggtgctgtgcgatggggctaaa
tgcaatcttggcgagagtttagaattgttaaaagaaatgaatcatatcttatccgttgaa
attggaaagatcgctaaattagacaatgtcatgtatgtgccaggtttgcctaaaaccagg
agcgggaaaatcatgagaaggcttttgaaatctatcgccaaaaaagagcccatcactcaa
gatttaagcacgctagaagatgtgaatgtggtcaaagaaataatgagtatcgctcaaatg
gaagagtga

DBGET integrated database retrieval system