KEGG   Helicobacter pylori PeCan4: HPPC_02025Help
Entry
HPPC_02025        CDS       T01322                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPPC_02025
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC_02025
   00620 Pyruvate metabolism
    HPPC_02025
   00640 Propanoate metabolism
    HPPC_02025
  Energy metabolism
   00680 Methane metabolism
    HPPC_02025
Enzymes [BR:hpc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPPC_02025
Lipid biosynthesis proteins [BR:hpc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPPC_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(397601..399589)
Genome map
AA seq 662 aa AA seqDB search
MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANEDYEHFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIVIRNAKEIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLESLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRASCATLPLPGIHAEVLNKDGTKTKPGEQGFLCITKPWPSMV
RNIWGDEKRYIDSYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSVE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIAQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagacgatgatttagaattcgctaaaaaaatttttaaccctaacagagcgttt
gccaagcaggctaggattaaaaacatgtgcgaatataaagatttagtgcatgaagccaat
gaagattatgaacatttttggggcgagttagccaaacaaaaactcacatggtttaaacct
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaaa
atcaatgtttcttacaattgcatagacaggcatttaaaagacaaaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgataga
gtcattatctatatgcctatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttgagggatagg
atcaacgacgctcaagctaaattagttatcacagcggacgggacttttagaaaaggcaaa
ccctacatgctcaagccagcccttgacaaggctctagaaaataatgcctgccctagcgtg
gaaaaagcgctcattgtgatacgaaacgccaaagagattgactatgtgagagggcgcgat
tttgtctataatgaaatggtcaattaccaatccgataaatgcgaacctgaaatgatggac
tctgaagatcctttattcttgctctatacaagcggatcaaccgggaaacctaaaggcgtt
caacacagcagtgcagggtatttgctgtgggcacaaatgacgatggagtgggtttttgat
attagagataacgataatttttggtgcaccgctgatattggctggatcacagggcacact
tatgtggtttatgggcctttagcttgtggggcgacgactttgatactagaaggcacgatg
tcttatccggattatgggagatggtggaggatgatagaagaataccgcgtggataaattc
tacacttcccccaccgctataagaatgctgcatgccaaaggcgaaaacgaacccttaaaa
tataatttagaatcgctcaaagttttaggaacggtgggagagcccattaaccctacggca
tggaaatggttttatgaaaaaatcggtaactcaaaatgcagtatcgtggatacttggtgg
caaacagaaacaggcgggcatatcatcagccctttaccgggagctacgcctataagggcc
agctgtgcaactttacctttgcctggcatccatgcggaagttttaaacaaagacggcacc
aaaacaaagcccggagagcaagggtttttatgcatcactaagccatggccttctatggta
agaaacatttggggcgatgaaaaacgatacattgatagctatttttctcagatcaagttg
aatggggaatatgtctacctctctggagatggcgctattgtggatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagcgggcataggattggcacggct
gaagtggagagcgctatttctaaacatgaaatggtggttgaatgcgcagtagtgggtatc
cctgatacgattaaaggagagggcttgtttgcgtttgtggtgctgtgcgatggggctaaa
tgcaatcttggcgagagtttagaattgttaaaagaaatgaatcatatcttatccgttgaa
attggaaagatcgctaaattagacaatgtcatgtatgtgccaggtttgcctaaaaccagg
agcgggaaaatcatgagaaggcttttgaaatctatcgccaaaaaagagcccatcactcaa
gatttaagcacgctagaagatgtgaatgtggtcaaagaaataatgagtatcgctcaaatg
gaagagtga

DBGET integrated database retrieval system