KEGG   Helicobacter pylori PeCan4: HPPC_02075Help
Entry
HPPC_02075        CDS       T01322                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408967..409458
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
VYINPPFGYTNQPNFYNATIILKTSLSLCHFFALVFYIERRFGRQRKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHLKWSERDSVLVPLALQQILFEKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggttgggatctaatctcaaaaatcctttaaaaatatta
aaaaattgttttttgtattttaaaaatcatagtaaaatcgggaaaattttttcttcgcct
gtttatatcaatccgccttttggttacactaatcaacctaacttctataacgctacgatt
atccttaaaacatctttaagtttgtgccattttttcgctctggttttttatatagaaagg
cgttttgggcgccaaaggaaacgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaatcaagtcattttaagacagaacgatctgactttacctcatcttaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttgaaaaa
ggggagtggtga

DBGET integrated database retrieval system