KEGG   Helicobacter pylori PeCan4: HPPC_04450Help
Entry
HPPC_04450        CDS       T01322                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891685..892236)
Genome map
AA seq 183 aa AA seqDB search
MIVGLIGVVEKISALEVHIEVQGVVYGVQVSMRTAALLQAGQKARLKILQVIKEDAHLLY
GFLEESEKILFERLLKINGVGGRIALAILSSFSPNEFENIIATKEVKRLQQVPGIGKKLA
DKIMVDLIGFFIQDETKPMHNEVFLALESLGFKSAEINKVLKTLKPHLSTEAAIKEALQQ
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggtttgataggggttgtggaaaaaatctctgctttagaagtgcatatagaa
gtgcaaggggttgtttatggggtgcaagtttctatgcgaacggctgctttgcttcaagcg
ggccaaaaagcgcgtttgaaaatcttgcaagtgatcaaagaagatgcgcatctcttatac
gggtttttagaagagagcgaaaaaatcctctttgaaaggcttttaaaaatcaatggggta
ggggggcgtatcgctttagccattctttcaagcttttcaccgaatgaatttgaaaacatt
atcgccactaaagaagtcaaaagactccagcaagtcccaggtattggcaaaaagctcgct
gataagatcatggtggatttgattggttttttcattcaagatgaaacaaaacccatgcat
aatgaagtctttttagccctagagagtttgggttttaaaagcgctgaaatcaataaagtt
ttaaaaaccctaaaaccccatctcagcaccgaagcagcgattaaagaagccttacaacaa
ctgcgctcttaa

DBGET integrated database retrieval system