KEGG   Helicobacter pylori PeCan4: HPPC_04660Help
Entry
HPPC_04660        CDS       T01322                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPPC_04660 (recR)
DNA repair and recombination proteins [BR:hpc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HPPC_04660 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
945589..946170
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CASCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaaatccgcctttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcgctcaagatcacgcacgctttagagaacgccctggaaaaccttaaaaca
tgcgcatcttgtaacgcgctcagtgagagtgaggtttgtgagatttgctctgatgagagc
cggcaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaggat
ttaaaggattttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctctaatgctttatattgaagataaattgcagcatttccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggattaaagcatga

DBGET integrated database retrieval system