KEGG   Helicobacter pylori PeCan4: HPPC_05215Help
Entry
HPPC_05215        CDS       T01322                                 

Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:hpc00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hpc00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hpc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1061081..1062427
Genome map
AA seq 448 aa AA seqDB search
MYIEKILQSLQKKYPYQKEFHQAVCEAITSLKPLLDSDKSYEKHAILERLIEPEREIFFR
VCWLDDNNQIQVNRGCRVEFNSAIGPYKGGLRFHPSVNESVIKFLGFEQVLKNSLTTLAM
GGAKGGSDFDPKGKSEHEIMRFCQAFMNELYRHIGATTDVPAGDIGVGEREIGYLFGQYK
KLVNRFEGVLTGKGLTYGGSLCRKEATGYGCVYFAEEMLQERNSSLEGKVCSVSGSGNVA
IYTIEKLLQIGAKPVTASDSNGMIYDKDGIDLELLKEIKEIRRGRIKEYALQKPSAKYTS
IENYPKGGNAIWHVPCFAAFPSATENELSVLDAKTLLSNGCKCVAEGANMPSSNEAIELF
LQAKISYGIGKAANAGGVSVSGLEMAQNASMHPWSFEVVDAKLHHIMKEIYKNVSQTAKE
FKDPTNFVLGANIAGFRKVASAMIAQGV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtatattgaaaaaatcctccaatctttacagaaaaaatacccctatcaaaaagagttc
catcaagccgtctgtgaagctatcacttctttaaaaccccttttagacagcgataaaagt
tatgaaaagcatgccattttagagcgtttgattgagcctgaaagggagattttttttagg
gtgtgttggctggatgataacaaccagattcaagtcaatcgggggtgtagggttgaattc
aattcagcgattggcccttataaggggggtttgagattccaccctagcgtgaatgaaagc
gtgatcaagtttttaggctttgagcaagtgttgaaaaattcgctcaccactttggctatg
gggggcgctaagggggggagcgattttgaccctaaaggaaagagcgagcatgagatcatg
cgtttttgccaggcgttcatgaacgaattataccgccatattggggccacgactgatgtg
ccagccggagatattggagtgggcgaaagagagattggctatctgtttgggcaatacaag
aaattagtcaatcgttttgagggcgtattgaccggtaaagggctcacttatggggggagt
ttgtgcagaaaagaagctaccggttatgggtgcgtgtattttgcggaagaaatgttgcaa
gaaaggaacagctctttagagggtaaggtttgcagcgtttctgggagcggtaatgtcgca
atttacaccattgaaaaactgcttcaaataggagctaaaccggtaacggcgagcgattct
aatggcatgatttatgataaagacggcattgatttagagcttttgaaagaaattaaagaa
atccgtcgtgggaggatcaaagagtacgccctacaaaaaccaagtgcgaaatacacctcc
atagaaaattaccccaaaggggggaatgctatatggcatgtgccttgttttgcggctttt
cctagcgcgaccgagaatgaattgagcgttttagacgctaaaactctcctttctaacggg
tgcaaatgcgtggctgaaggggcgaacatgccctcaagcaatgaagcgattgaattgttt
ttgcaggctaagatttcttatggtataggtaaggcggctaatgctgggggggtgagcgtg
agcggcttggaaatggcgcaaaatgcgagcatgcacccttggagttttgaagtggtggat
gcgaaattgcaccacatcatgaaagagatttataagaatgtttctcaaaccgctaaagag
tttaaagatcctactaattttgttttaggggctaatatcgctggttttagaaaagtggcg
tcggcgatgatagcgcaaggggtttaa

DBGET integrated database retrieval system