KEGG   Helicobacter pylori PeCan4: HPPC_05395Help
Entry
HPPC_05395        CDS       T01322                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00010  Glycolysis / Gluconeogenesis
hpc00020  Citrate cycle (TCA cycle)
hpc00620  Pyruvate metabolism
hpc00640  Propanoate metabolism
hpc00650  Butanoate metabolism
hpc00680  Methane metabolism
hpc01100  Metabolic pathways
hpc01120  Microbial metabolism in diverse environments
hpc01130  Biosynthesis of antibiotics
hpc01200  Carbon metabolism
Module
hpc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC_05395 (porA)
   00020 Citrate cycle (TCA cycle)
    HPPC_05395 (porA)
   00620 Pyruvate metabolism
    HPPC_05395 (porA)
   00640 Propanoate metabolism
    HPPC_05395 (porA)
   00650 Butanoate metabolism
    HPPC_05395 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPPC_05395 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPPC_05395 (porA)
Enzymes [BR:hpc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPPC_05395 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADO07291
UniProt: E1Q343
Position
1098057..1099280
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFKIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIVHLCEIFKEINEDALKGTLTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaactacaagagatagaggtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgagtttgtt
ttagtggaatctgagcatgccgccatgagcgcatgcgtgggagctgcagcagctggaggg
agagtcagcactgcgaccagctctcaaggtttggcgttaatggtagaggttttataccaa
gcttctggcatgcgtttgcctatcgttttgaatttagtcaatcgtgctctagcagcccct
ttgaatatccatggcgatcattctgatatgtatttaagcagggattcaggctggatcagt
ttatgcacatgcaaccctcaagaagcttacgatttcactttaatggcgtttaaaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagacgggtttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttatcaattcgtgggcgaatac
caaaccaagcattcccttttggattttgataaaccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcacaggcaggcaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaggaaatgcgtaaaaaaggcattaaggccggcgtggccacc
atccattccttacgccccttcccttatgaaagattggggcaggatttgaaaaatcttaag
gctttagcgattttagacaagagctctccagcaggcgctatgggagcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacccaagggactaaacaccccgtggtgtctaactatatc
tatggtttaggcgaaagagatatgacaatcgtgcatttatgcgaaatttttaaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcgt
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system