KEGG   Helicobacter pylori PeCan4: HPPC_06285Help
Entry
HPPC_06285        CDS       T01322                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPC_06285
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPC_06285
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPC_06285
Enzymes [BR:hpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPPC_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1275698..1276879)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESGRAIYESASDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgagaaatttcaa
aaagaatatttccatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggggcgcacaagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggtgctgggcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccaa
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtcagagaggttaattcaggg
agcgctacgcttaaagacgctgtgaatgaggccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccccacgatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggaatatttagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagtgggcgtgcg
atttatgaaagcgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcactagaaagctcacacgccttagcgtatgccttaaaactagct
caaaaatgcgaagaagaaagcatcatcgtagtgaatttaagcggtcgtggggataaggat
ctaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system