KEGG   Helicobacter pylori PeCan4: HPPC_06285Help
Entry
HPPC_06285        CDS       T01322                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00260  Glycine, serine and threonine metabolism
hpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpc01100  Metabolic pathways
hpc01110  Biosynthesis of secondary metabolites
hpc01130  Biosynthesis of antibiotics
hpc01230  Biosynthesis of amino acids
Module
hpc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPC_06285
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPC_06285
Enzymes [BR:hpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPPC_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADO07465
UniProt: E1Q3N6
Position
complement(1275698..1276879)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESGRAIYESASDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgagaaatttcaa
aaagaatatttccatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggggcgcacaagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggtgctgggcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccaa
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtcagagaggttaattcaggg
agcgctacgcttaaagacgctgtgaatgaggccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccccacgatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggaatatttagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagtgggcgtgcg
atttatgaaagcgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcactagaaagctcacacgccttagcgtatgccttaaaactagct
caaaaatgcgaagaagaaagcatcatcgtagtgaatttaagcggtcgtggggataaggat
ctaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system