KEGG   Helicobacter pylori PeCan4: HPPC_06290Help
Entry
HPPC_06290        CDS       T01322                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpc01100  Metabolic pathways
hpc01110  Biosynthesis of secondary metabolites
hpc01130  Biosynthesis of antibiotics
hpc01230  Biosynthesis of amino acids
Module
hpc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPC_06290
Enzymes [BR:hpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPPC_06290
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPPC_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADO07466
UniProt: E1Q3N7
Position
complement(1276881..1278239)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVFMLKKNHALPTNINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKIAKTYEKFASCISVLADSKYFLGSYENIKIVSQHSIKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIKRLLKLQYDIIGI
NNRDLHTLTTDINNTLKLRPLLPKDALVVSESGIYSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQQEIAQLKKSLPKTCAIWQVGSVMD
ANDLAPKAKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLETSPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtttttatgctcaaa
aaaaatcacgctttaccgacaaatataaacccaagcgatagggattttaaaaaggcgtta
ctagaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttgaaaatagccaagacttatgaaaaattcgcctcttgc
atttcagttttagccgattctaaatattttttaggctcttatgaaaacattaagatcgtt
tcgcaacattccattaagcccattttatgcaaagattttatcattgatgcttttcaaatc
aaactcgctagaatgatgggggctaatgcggtgcttttaatgttaagcgtattagatgat
aaaaattatttagagcttttcaacctcgctaaatccttaaacatgagcgtgctaactgaa
gtttccaaccagcaagaaatcaagcgcttgctcaaactccaatacgacattatcggcatc
aataacagggatttacacaccctgacaaccgacattaacaacacgctcaaattacgcccc
cttttgcctaaagacgcgctcgtggtgagtgagtccggtatttattcgcatgcgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgagaataaagtgtgcgggcttaca
aggattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgccccgatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataagattaaaaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcagctttatggctattcgcaacaagaaatcgct
caattaaaaaaatcgctccctaaaacttgcgcgatttggcaagtagggagtgtgatggac
gctaacgatttagcgcctaaagctaaagaggcctctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggtattttagaaaatgtcaaaacg
cctttcatgttagctggcgggcttaatttggacaatattcaaaaagccttaaaagttaaa
gcgttgggtttggatttcaattcaggtttagaaacaagccccgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system