KEGG   Helicobacter pylori PeCan4: HPPC_07035Help
Entry
HPPC_07035        CDS       T01322                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hpc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1405021..1405827
Genome map
AA seq 268 aa AA seqDB search
MTHVFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKNALSFSLKGDFDCPL
EENSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHL
NQIFDCRLSLKELYTVGSLVGADTNFFISQYKSANATSYGEVIENFEEEPLENRLEIYAP
NHVFCSTKAVYQAYKPETCFSQANEWLKKPSLECLKTCDRNGLNDLLKPALLTNQALRDI
ESELGKEWFFSGSGSAFFRLKPIQKGGE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcatgtttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaa
gaaggggcttaccacaagctcatttctcgcatgtgtttggtcaaagacaagctcaaagac
attatcagcgtcaaaaatgccttatctttctcattaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaaattttaaagaattttttaaaatcaaaaaat
ttctctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatc
cccactcaagccgggttaggcggtgggagcgctgatgctggggggctgttgtatcattta
aatcaaatatttgattgtcgtttgagtttaaaagagctttatactgtggggtctttagtg
ggtgcagacaccaactttttcatctcgcaatacaaaagcgctaacgccacttcttatggc
gaagtcattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgctcca
aatcatgttttttgcagcaccaaagccgtttatcaagcttataaacctgaaacttgtttc
tctcaagctaatgagtggcttaaaaagccgagtttagaatgcctaaagacttgcgacaga
aacggattaaacgatcttttaaaaccagccctactcactaaccaagctttaagagatata
gaaagtgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggcta
aagcctatacaaaaagggggcgaatga

DBGET integrated database retrieval system