KEGG   Helicobacter pylori PeCan4: HPPC_07545Help
Entry
HPPC_07545        CDS       T01322                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00220  Arginine biosynthesis
hpc00330  Arginine and proline metabolism
hpc01100  Metabolic pathways
hpc01110  Biosynthesis of secondary metabolites
hpc01130  Biosynthesis of antibiotics
hpc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPPC_07545
   00330 Arginine and proline metabolism
    HPPC_07545
Enzymes [BR:hpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPPC_07545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADO07717
UniProt: E1Q517
Position
complement(1513816..1514784)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGVQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDTKHIHGMPLGMVLNRVHSGVNRMNESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELEIPLFSVGAIRENMQGVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLDLLLESFKDRLGALEVTEYNPTVSVKHDNEEEKQVLE
ILDLIINRCKIKDKERSFAMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagccttaagcgcaacgcatggcgatgtgattaaaggcgtacaa
acgatcactcaagagcggtgcgtgctttataaggagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatctgatcccttgcatgaaagaagtgtttgagaaa
aaagaattccctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgatacaaagcacattcacggcatgcctttaggcatggtt
ttaaatcgtgtccatagtggggttaatcgcatgaacgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttggaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcacagaacaaagcgaaagagatgtgattaaggaattagaaatc
cctttatttagcgtgggcgcgataagagaaaacatgcaaggagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttaccttagcttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaaag
caattactggacttgcttttagaaagttttaaggaccgattaggagcgcttgaggtaacc
gaatacaaccccacggtgagcgtcaaacacgataacgaagaagaaaagcaggttttagaa
atcttggatctcatcatcaatcgctgtaaaattaaagacaaggagcgatcttttgcaatg
agtcgctga

DBGET integrated database retrieval system