KEGG   Helicobacter pylori PeCan4: HPPC_07545Help
Entry
HPPC_07545        CDS       T01322                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hpc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1513816..1514784)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGVQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDTKHIHGMPLGMVLNRVHSGVNRMNESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELEIPLFSVGAIRENMQGVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLDLLLESFKDRLGALEVTEYNPTVSVKHDNEEEKQVLE
ILDLIINRCKIKDKERSFAMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagccttaagcgcaacgcatggcgatgtgattaaaggcgtacaa
acgatcactcaagagcggtgcgtgctttataaggagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatctgatcccttgcatgaaagaagtgtttgagaaa
aaagaattccctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgatacaaagcacattcacggcatgcctttaggcatggtt
ttaaatcgtgtccatagtggggttaatcgcatgaacgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttggaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcacagaacaaagcgaaagagatgtgattaaggaattagaaatc
cctttatttagcgtgggcgcgataagagaaaacatgcaaggagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttaccttagcttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaaag
caattactggacttgcttttagaaagttttaaggaccgattaggagcgcttgaggtaacc
gaatacaaccccacggtgagcgtcaaacacgataacgaagaagaaaagcaggttttagaa
atcttggatctcatcatcaatcgctgtaaaattaaagacaaggagcgatcttttgcaatg
agtcgctga

DBGET integrated database retrieval system