KEGG   Helicobacter pylori 51: KHP_0114Help
Entry
KHP_0114          CDS       T02082                                 

Gene name
fucA
Definition
l-fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpd  Helicobacter pylori 51
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KHP_0114 (fucA)
Enzymes [BR:hpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KHP_0114 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
130174..130812
Genome map
AA seq 212 aa AA seqDB search
MINMNTHTRGIDSNLIHSLKSISLSMFRKGFFGLYQGSISARIGANQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPK
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgataaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctcaaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcgcgcattggcgcaaatcaatttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttactggttttgcatgacaagattgattatcgttggaaagaagcgagc
ttggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tacgcgcgccctccttatagtttggcgtattccttacgccataaccgattgctccctaaa
gattatttagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaactacaagagagcaaaaaa
tattttgtcttcattaaggggtgcgggatttttgcctaccacagggagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system