KEGG   Helicobacter pylori 51: KHP_0866Help
Entry
KHP_0866          CDS       T02082                                 

Gene name
folE_2
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hpd  Helicobacter pylori 51
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944646..945188
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFLGNISLGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTTQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLKGLFKKDPKTRAEFMQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccaattttttgaaaatatcggcgaagataaaaacagagaaggt
ctaaaagaaacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagatcctagagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgaacaccacttgctcccttttttaggg
aatatcagtttaggatacattcctaaagaaaagattgtaggcattagcgcgatcgccaaa
ctcattgaaatttatagcagacgcttgcaaatccaagaaaggctgaccactcaaattgcc
gaaacctttgatgaaatcatagagccaagaggcgtgattgtggtttgtgaagccaagcat
ttgtgcatgagtatgcaaggggtgcaaaagcaaaatgcgatcattaaaacaagcgtttta
aaaggcctctttaaaaaagaccctaaaaccagagctgaatttatgcaactcttaaaatct
tag

DBGET integrated database retrieval system