KEGG   Helicobacter pylori 51: KHP_0866Help
Entry
KHP_0866          CDS       T02082                                 

Gene name
folE_2
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hpd  Helicobacter pylori 51
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KHP_0866 (folE_2)
Enzymes [BR:hpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KHP_0866 (folE_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944646..945188
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFLGNISLGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTTQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLKGLFKKDPKTRAEFMQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccaattttttgaaaatatcggcgaagataaaaacagagaaggt
ctaaaagaaacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagatcctagagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgaacaccacttgctcccttttttaggg
aatatcagtttaggatacattcctaaagaaaagattgtaggcattagcgcgatcgccaaa
ctcattgaaatttatagcagacgcttgcaaatccaagaaaggctgaccactcaaattgcc
gaaacctttgatgaaatcatagagccaagaggcgtgattgtggtttgtgaagccaagcat
ttgtgcatgagtatgcaaggggtgcaaaagcaaaatgcgatcattaaaacaagcgtttta
aaaggcctctttaaaaaagaccctaaaaccagagctgaatttatgcaactcttaaaatct
tag

DBGET integrated database retrieval system